KEGG   Saccharomyces cerevisiae (budding yeast): YFL029C
Entry
YFL029C           CDS       T00005                                 
Symbol
CAK1, CIV1
Name
(RefSeq) cyclin-dependent protein kinase-activating kinase CAK1
  KO
K06667  serine/threonine-protein kinase CAK1 [EC:2.7.11.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YFL029C (CAK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     YFL029C (CAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal YrbL-PhoP_reg APH ABC1 Kdo FAM150 FTA2
Other DBs
NCBI-GeneID: 850515
NCBI-ProteinID: NP_116624
SGD: S000001865
UniProt: P43568
LinkDB
Position
VI:complement(78055..79161)
AA seq 368 aa
MKLDSIDITHCQLVKSTRTARIYRSDTYAIKCLALDFDIPPHNAKFEVSILNKLGNKCKH
ILPLLESKATDNNDLLLLFPFEEMNLYEFMQMHYKRDRRKKNPYYDLLNPSIPIVADPPV
QKYTNQLDVNRYSLSFFRQMVEGIAFLHENKIIHRDIKPQNIMLTNNTSTVSPKLYIIDF
GISYDMANNSQTSAEPMDSKVTDISTGIYKAPEVLFGVKCYDGGVDVWSLLIIISQWFQR
ETSRMGHVPAMIDDGSDDMNSDGSDFRLICSIFEKLGIPSIQKWEEVAQHGSVDAFVGMF
GADGDGKYVLDQEKDVQISIVERNMPRLDEIADVKVKQKFINCILGMVSFSPNERWSCQR
ILQELEKP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaaactggatagtatagacattacacactgtcagttggtcaaatctactagaactgct
aggatttataggtcggatacatatgccattaaatgtctagcactagatttcgatatcccg
ccacataacgccaaattcgaagtatcgatattaaacaaactgggcaacaaatgtaagcac
atcttacctcttctagagtctaaggctaccgataataatgacctattgttgttgtttccc
tttgaagagatgaacctttatgagttcatgcaaatgcactataaaagagatagaagaaaa
aaaaatccctattacgatttgctaaatcccagtatcccaattgttgcggacccccccgtt
cagaaatatactaatcaattggacgtcaatcggtattctttgtcctttttccggcaaatg
gttgaagggattgcattcttacatgagaacaagatcattcaccgcgacatcaaaccgcaa
aatatcatgctaacaaacaataccagcaccgtatccccaaagttgtacataattgatttt
ggcatctcttatgacatggcaaataactcacaaacaagtgcggaacccatggatagcaag
gtgacggatataagcacaggaatttacaaggccccagaagtgctttttggagtaaaatgc
tatgatggtggcgtggacgtgtggtcgttgttgataattatttctcagtggttccagaga
gaaacaagccgtatggggcacgttccggccatgattgatgacggcagcgacgacatgaac
tcagatggaagcgatttcagactgatttgctcaatattcgaaaagttgggcataccgtcc
attcagaaatgggaagaggttgcgcaacacggctcggttgatgcatttgttggtatgttt
ggtgcagatggcgatggcaagtatgtactggaccaggagaaagatgtacagattagcatt
gttgagaggaatatgcctcgactggacgagattgcggatgtcaaagtcaagcagaagttc
attaattgtatcctggggatggtttcattttcaccaaacgaaagatggagctgtcaaaga
atcttgcaagaattagaaaagccataa

DBGET integrated database retrieval system