KEGG   Saccharomyces cerevisiae (budding yeast): YFR034C
Entry
YFR034C           CDS       T00005                                 
Symbol
PHO4
Name
(RefSeq) phosphate-sensing transcription factor PHO4
  KO
K06658  phosphate system positive regulatory protein PHO4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YFR034C (PHO4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YFR034C (PHO4)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Fungal regulators
    YFR034C (PHO4)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 850594
NCBI-ProteinID: NP_116692
SGD: S000001930
UniProt: P07270
Structure
LinkDB
Position
VI:complement(225020..225958)
AA seq 312 aa
MGRTTSEGIHGFVDDLEPKSSILDKVGDFITVNTKRHDGREDFNEQNDELNSQENHNSSE
NGNENENEQDSLALDDLDRAFELVEGMDMDWMMPSHAHHSPATTATIKPRLLYSPLIHTQ
SAVPVTISPNLVATATSTTSANKVTKNKSNSSPYLNKRRGKPGPDSATSLFELPDSVIPT
PKPKPKPKQYPKVILPSNSTRRVSPVTAKTSSSAEGVVVASESPVIAPHGSSHSRSLSKR
RSSGALVDDDKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAAC
RYIRHLQQNVST
NT seq 939 nt   +upstreamnt  +downstreamnt
atgggccgtacaacttctgagggaatacacggttttgtggacgatctagagcccaagagc
agcattcttgataaagtcggagactttatcaccgtaaacacgaaacggcatgatgggcgc
gaggacttcaacgagcaaaacgacgagctgaacagtcaagagaaccacaacagcagtgag
aatgggaacgagaatgaaaatgaacaagacagtctcgcgttggacgacctagaccgcgcc
tttgagctggtggaaggtatggatatggactggatgatgccctcgcatgcgcaccactcc
ccagctacaactgctacaatcaagccgcggctattatattcgccgctaatacacacgcaa
agtgcggttcccgtaaccatttcgccgaacttggtcgctactgctacttccaccacatcc
gctaacaaagtcactaaaaacaagagtaatagtagtccgtatttgaacaagcgcagaggt
aaacccgggccggattcggccacttcgctgttcgaattgcccgacagcgttatcccaact
ccgaaaccgaaaccgaaaccaaagcaatatccgaaagttattctgccgtcgaacagcaca
agacgcgtatcaccggtcacggccaagaccagcagcagcgcagaaggcgtggtcgtagca
agtgagtctcctgtaatcgcgccgcacggatcgagccattcgcggtcgctgagtaagcga
cggtcatcgggcgcgctcgtggacgatgacaagcgcgaatcacacaagcatgcagagcaa
gcacggcgtaatcgattagcggtcgcgctgcacgaactggcgtctttaatccccgcggag
tggaaacagcaaaatgtgtcggccgcgccgtccaaagcgaccaccgtggaggcggcctgc
cggtacatccgtcacctacagcagaacgtgagcacgtga

DBGET integrated database retrieval system