KEGG   Saccharomyces cerevisiae (budding yeast): YGL092W
Entry
YGL092W           CDS       T00005                                 
Symbol
NUP145, RAT10
Name
(RefSeq) nucleocytoplasmic transporter NUP145
  KO
K18720  nucleoporin NUP145
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YGL092W (NUP145)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGL092W (NUP145)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YGL092W (NUP145)
SSDB
Motif
Pfam: Nucleoporin2 Nup96 Nucleoporin_FG
Other DBs
NCBI-GeneID: 852788
NCBI-ProteinID: NP_011423
SGD: S000003060
UniProt: P49687
Structure
LinkDB
Position
VII:337906..341859
AA seq 1317 aa
MFNKSVNSGFTFGNQNTSTPTSTPAQPSSSLQFPQKSTGLFGNVNVNANTSTPSPSGGLF
NANSNANSISQQPANNSLFGNKPAQPSGGLFGATNNTTSKSAGSLFGNNNATANSTGSTG
LFSGSNNIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTT
GLFGSNNTQSSTGIFGQKPGASTTGGLFGNNGASFPRSGETTGTMSTNPYGINISNVPMA
VADMPRSITSSLSDVNGKSDAEPKPIENRRTYSFSSSVSGNAPLPLASQSSLVSRLSTRL
KATQKSTSPNEIFSPSYSKPWLNGAGSAPLVDDFFSSKMTSLAPNENSIFPQNGFNFLSS
QRADLTELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSENEPIANADSVTNIDR
KENRDNNLDNTYLNGKEQSNNLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAA
VSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGH
GLNVPAIITLENVYPVDKKTKKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTF
KVNHFSIWGLVNEEDAEIDEDDLSKQEDGGEQPLRKVRTLAQSKPSDKEVILKTDGTFGT
LSGKDDSIVEEKAYEPDLSDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFD
GPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKR
LPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLW
KLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQI
FLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNI
SKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPY
DDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEAT
FAFAAQLEFAQLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPS
QLIFNAQALKDRYEGNYLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTL
REILNEFPDSERDKWSVSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVA
ACCNVMSQEIVSKILEKNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI
NT seq 3954 nt   +upstreamnt  +downstreamnt
atgtttaataaaagtgtaaatagtggtttcacctttggaaaccaaaacacatccacaccg
acatccactccggcacagccttccagttcccttcaattccctcaaaaatctactgggtta
tttgggaacgttaatgttaatgcgaatacttcaacacctagcccatctggtggattattc
aatgccaattcaaacgctaattctataagtcaacaacccgccaataattcattatttgga
aataaaccagcacaaccatcaggtggcttatttggcgctacaaacaatactacttctaaa
agtgccggaagcttattcggaaataataatgccacagcaaattctacgggctctacaggt
ttattcagtggtagcaataatatagcctctagtacccaaaatggtggtttgtttggtaat
agcaacaataacaatataacttctaccacgcaaaatggtggtctgttcggtaagcctact
acaacccctgctggtgctggcggcctgtttggaaattcctcatcgacaaactcaacgaca
ggattatttggatcaaataatacacaaagttctacaggtatttttggtcaaaagccggga
gcttcaacaactgggggattgtttggaaataatggtgcttcattcccaagatccggtgaa
actactggaaccatgtcaaccaacccatatggaattaacataagtaatgttcctatggca
gtggctgacatgccaagatctattacgtcttctctatcagatgtgaatggcaagtcagat
gcggaacccaaaccaattgaaaatagaagaacatattcgttttcttcctcagtttcaggg
aacgctcctttaccactcgcctcacagtcaagtttagtgagtagactaagcacgagactg
aaagccactcagaaaagcacgtcaccgaatgaaatattttcaccgtcttacagtaaaccg
tggctgaatggagcaggttcagctcccttagtagatgactttttttcttcaaagatgact
tctttggctccaaatgaaaacagcatctttcctcagaatggttttaatttcctatcctcc
caaagggccgacttgacagagctgcgtaaattgaaaattgattccaacagaagtgctgca
aaaaaattaaaactcctctctggtactcccgccatcacaaaaaaacatatgcaagacgaa
caagattcatcggaaaatgagccaattgcaaatgctgatagtgtcactaacattgacagg
aaagaaaatagagataataatttggataacacttatttgaatggaaaggagcaatcgaat
aacttgaataaacaagacggcgaaaatactttacaacatgaaaagtcatcaagttttggt
tattggtgttctccttccccagaacagctggagcgtttgtcattgaagcaattagcggcc
gtttcaaattttgttatcgggagaagaggttatggttgtattacatttcaacatgatgtg
gatctcacagcttttaccaaaagctttagagaagaactattcggtaaaattgtaatattt
cgttcctctaagacagtagaagtatatcctgacgaagccaccaaaccaatgattgggcat
gggttaaacgttcccgctataatcactctagagaatgtttatcctgtagataaaaaaaca
aaaaaaccgatgaaagatacgacgaagtttgctgaatttcaagtttttgacaggaaacta
agaagcatgagggaaatgaactatatatcctataatccctttggcgggacttggactttc
aaagtcaatcattttagcatttgggggttagtcaatgaagaagatgcggaaatagatgaa
gacgatttgagtaaacaagaagacggcggtgagcaaccattaagaaaggtgcgcacgtta
gcgcaatcaaaaccatcggataaagaggttatcctcaaaacagatggcacttttggaact
ctatcaggtaaagacgactctatcgttgaggaaaaggcatacgaacctgatttgtctgat
gcggactttgagggaattgaagcttcccctaaacttgacgtttctaaggattgggtagaa
caattaattttagctgggtcttcactacgttctgtgtttgccacttctaaagaatttgac
gggccatgtcaaaatgaaatagatttactcttttccgaatgcaatgatgaaattgataac
gcaaaactcatcatgaaggaaagaagatttacagcctcttatacgtttgcaaaattttca
acaggttcaatgctactgacaaaagatattgttggtaaatcgggcgtttcaattaagcgt
ttaccaactgagttgcaaagaaaatttttattcgatgacgtctatttagataaagaaatt
gaaaaggttactatcgaagcaaggaagtcaaacccatacccacaaattagtgaaagctct
ttactctttaaagatgctttagattatatggaaaaaacctctagtgattacaatctatgg
aaactttcatctattttattcgaccccgtttcctatccatacaagacggacaatgatcaa
gtaaaaatggcattattaaaaaaagaaaggcattgtcgattaacttcgtggattgttagc
cagataggtccggaaattgaagagaaaattaggaattcttctaacgaaatagaacaaata
tttctatatttgctcttgaatgatgtcgtaagggcatccaagttagcaattgagtctaag
aatggtcatttgagcgttttgatatcctatttgggttcaaacgacccaaggatacgtgat
ttagcggaattacaattgcaaaagtggtcaactggtggttgtagtatcgacaagaatatc
tcgaagatttacaaattactaagcggttcaccttttgaaggtttattttctcttaaggaa
cttgaaagtgaattcagttggttgtgccttttgaatttgacactgtgctacggccagata
gatgagtattccttagaatctcttgtgcaatcgcatttagacaagttttctttaccctat
gatgatcctattggagttattttccaactatatgctgctaatgaaaatacggagaagctc
tataaggaggttagacaaagaaccaacgctttagatgttcagttttgctggtacttgatt
caaacattgagatttaatggaacacgcgttttttcgaaggaaactagcgatgaggctaca
ttcgcatttgccgctcaacttgaatttgcacaattacatggccactctctttttgtttct
tgctttttaaatgatgacaaggcagcagaagataccataaaaaggcttgttatgcgtgaa
ataacattgttaagagcctctaccaatgatcacattttaaatagattaaagatcccttcg
caattgatattcaatgctcaagctttgaaagatagatatgaaggcaattacctttctgaa
gtacaaaatctactcctgggttcgtcttatgatttggcagaaatggctattgttacgtca
ttaggaccaaggctgttgttatcaaacaatcctgtacagaataatgaactgaaaactttg
agggaaattcttaacgaatttccagactctgagagggacaaatggagtgtaagtataaac
gtatttgaagtatatctaaagcttgtgttggataatgttgaaacgcaggagactatcgat
tcattaattagtggtatgaagatattttatgatcagtataagcactgtcgtgaagtggcc
gcatgttgtaatgttatgtcccaagagattgtatcaaaaatattggagaaaaacaatcct
tcaataggcgattcgaaggccaaattgcttgagctccccctagggcagccagaaaaggca
tacttgaggggtgagtttgcccaggatttaatgaagtgtacatataagatataa

DBGET integrated database retrieval system