KEGG   Saccharomyces cerevisiae (budding yeast): YGR003W
Entry
YGR003W           CDS       T00005                                 
Symbol
CUL3
Name
(RefSeq) cullin CUL3
  KO
K03869  cullin 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YGR003W (CUL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YGR003W (CUL3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YGR003W (CUL3)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     YGR003W (CUL3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     YGR003W (CUL3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 DUF512
Other DBs
NCBI-GeneID: 852886
NCBI-ProteinID: NP_011517
SGD: S000003235
UniProt: P53202
LinkDB
Position
VII:500132..502366
AA seq 744 aa
MITNKKIKISVPEKLGLSEESFEESWETVKYAIDHIYSDDMADLSFEQVYKTIYTIVLNK
KGPILYNRLKDYLIQKLALLRETIVKDNTHDYEFLGTMARLWEVQCHCFKITGDLMMYMD
KVYCKPNRCMEVYDMCLDLFRIEILQKCSSSLISALISDIERIRNLGSVDSEHTSLWKVL
IGMMETLHDNRDSFFLTDFEPVLISATEEYYNKAIDIELLTPIESLEKIRKLRQFESMLD
SSFLNVDSHNKLKTVLENVLIWGKLSDIIEDLTHEAMVISNGKLLQEIYDLSSEEKYRVT
VIESIKSYINKNAINIPFNEGNRKKGQNAITWSSEIVELYRSQHSFLESIDFGSVRLNNL
TGDVSNAILGDVFSMYFSKEGALPSEYLSTYVDHCMKRTKEKDAEIVKIKQDLLDSTKLI
GLLTEKDIFEKIYKKQLSRRLLQQRSLVEIEKWMVQMIKKVLGTFFTSKLEIMLRDISLS
SEMYQAFQHSTINSIEYLSFAPQVLTRTSWPFQSTNPIDEGISLPPRMSQILAGFEGYYS
LKYKERVLKWAHHLSVIEIGCQFNSGYYEISFSVYAGVIFLLFEDYEELTLGEIYELTHI
PIDDVKSLVMSMSTIPRCKILKKSSSSGNMKFSVNYFFSSPNRKVKVPVIACPLPSQKSD
NLATASSVDTYDNEIVMELSAIIVRIMKTEGKLSHQQLLERTTKRTQSRLSLTPSILKRS
IQLLIEKEYIQRNADDPSYYHYLS
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgataactaataagaaaataaagataagtgtcccagaaaaactcggtttgtcagaagaa
tcttttgaggaatcctgggaaacagttaaatatgccattgatcatatatacagcgatgac
atggccgacctttccttcgaacaagtgtacaagaccatttatactatcgttttaaataaa
aaggggccaatactttataacagattgaaagattatttaatccaaaaattagcgcttttg
agggaaacgatagtcaaggacaatactcatgattatgagtttcttggaactatggcacgg
ttatgggaggtgcaatgccattgttttaaaataacgggagacttaatgatgtatatggac
aaagtttattgcaaaccaaatagatgcatggaggtatacgacatgtgcctcgatcttttc
cgaatcgaaatattgcaaaaatgctcatcttctctcatctcagcactgatatctgatata
gaaaggattcgtaatttaggatctgtcgactccgaacatactagtttgtggaaagtacta
ataggaatgatggagacattacatgacaatagagatagttttttcttaaccgattttgag
ccggttttgattagcgcgacagaagaatactacaataaagctattgatattgaattatta
acgccaattgagagcctggaaaagattaggaagttaaggcagtttgaaagtatgctagac
tcctcttttctaaatgtggattctcataataagttgaagactgtattagaaaatgtcctt
atatggggaaagttgagtgatattattgaagatctaacgcacgaagcaatggtaatttca
aatggaaagctactccaagaaatttatgacttgtcaagcgaggaaaaatatcgcgttact
gtcattgaatctattaaatcttacatcaataaaaatgccataaatattccttttaatgaa
ggtaaccgcaaaaaagggcagaatgcgattacttggtcttcggaaattgtagagctatat
cgcagtcaacactcgtttttggaaagtattgattttggttctgttcgtcttaataatttg
accggggatgtatctaatgcaatacttggcgatgttttctcaatgtatttctctaaagaa
ggagcattaccatctgagtatctttctacctacgtggaccattgtatgaaacgaaccaag
gaaaaagatgctgaaatagtgaagatcaagcaagatttgcttgatagtaccaaattaatc
ggactcctaactgagaaggatatatttgaaaagatttacaaaaaacaactctccagaaga
ttactgcagcagaggtctttagtggaaattgaaaaatggatggtgcaaatgataaagaag
gttctaggaactttttttacctcaaaattggagataatgctgcgagatatatctttatcc
tctgaaatgtatcaagcattccaacactcaacaatcaacagcatagaatatttgagtttt
gcaccacaagttttgacgagaacgagctggccctttcagagtactaatccaattgatgaa
ggtatttcactacctcctagaatgtcacaaattttagctggctttgagggctattacagc
ttaaaatacaaagaaagagtgctaaagtgggctcatcatctaagtgtaattgaaattggc
tgccaatttaatagcggttactacgaaataagtttttctgtttacgctggagtgattttc
cttctatttgaagattatgaagaattaacgttgggggaaatatatgaactaactcatatt
cccatagatgacgttaagtctcttgtaatgtcaatgtcgacaatacccagatgtaagatt
ttgaaaaaatcatccagttcaggaaatatgaaattttcagttaattatttcttttcttct
ccaaacaggaaagtgaaagtgccggttattgcatgccctctaccatctcagaaatcagat
aatttggcaaccgcaagttccgtggacacttatgataatgaaattgttatggagcttagt
gctattattgttcgtatcatgaaaacagaaggtaagctaagccatcagcaattacttgaa
agaactacgaaacggacacagtctcggctcagtcttacaccgagcattttgaaacgaagc
attcagcttttaatagagaaagaatacatccagagaaacgcagatgacccctcttattac
cattacctttcctaa

DBGET integrated database retrieval system