KEGG   Saccharomyces cerevisiae (budding yeast): YGR092W
Entry
YGR092W           CDS       T00005                                 
Symbol
DBF2
Name
(RefSeq) serine/threonine-protein kinase DBF2
  KO
K06684  cell cycle protein kinase DBF2 [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    YGR092W (DBF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGR092W (DBF2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-
     YGR092W (DBF2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_C Kdo Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 852984
NCBI-ProteinID: NP_011606
SGD: S000003324
UniProt: P22204
Structure
LinkDB
Position
VII:668189..669907
AA seq 572 aa
MLSKSEKNVDLLAGNMSNLSFDGHGTPGGTGLFPNQNITKRRTRPAGINDSPSPVKPSFF
PYEDTSNMDIDEVSQPDMDVSNSPKKLPPKFYERATSNKTQRVVSVCKMYFLEHYCDMFD
YVISRRQRTKQVLEYLQQQSQLPNSDQIKLNEEWSSYLQREHQVLRKRRLKPKNRDFEMI
TQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKL
LYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRD
LKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIEDRRKM
YNQLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSST
NETYDNLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIADPINRLRSFEHVKRMSYFADI
NFSTLRSMIPPFTPQLDSETDAGYFDDFTSEADMAKYADVFKRQDKLTAMVDDSAVSSKL
VGFTFRHRNGKQGSSGILFNGLEHSDPFSTFY
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgctatcaaaatcagaaaaaaatgtcgacctcttggcaggcaatatgagcaatttgagt
ttcgatgggcatgggactcctgggggcactggactatttcctaaccaaaatataacaaag
aggaggacaaggcctgcgggtatcaatgattcaccttcgccggtaaaaccatcctttttt
ccttacgaagatacttccaacatggacatagacgaagtatctcaacctgatatggatgtc
tcgaactctcccaagaagcttccaccaaagttttacgaaagagcaacttcaaataaaaca
cagagagttgttagtgtttgcaaaatgtactttctagaacattactgtgatatgtttgac
tatgtaattagtagaagacaacgcacgaagcaagttctagaatacctgcaacagcaaagc
caacttccgaattctgaccagattaaactcaacgaagagtggtcctcttacttacaaagg
gaacatcaggttttgagaaaaagaaggttgaaaccaaaaaatagggattttgaaatgatc
acacaagtaggtcaaggtggttatgggcaagtttatttagccagaaagaaagacacaaaa
gaggtgtgtgctttgaaaattttgaacaaaaaactattgtttaagctcaacgagacaaaa
cacgttttaactgaaagagatatcctaaccacgacaaggtctgaatggttagtaaaactt
ctgtatgcattccaagacctacaaagtttatacctggctatggaatttgtaccaggcggt
gattttcgtacattattaataaatactagatgcttgaaaagtggccatgcgagattttac
atcagtgaaatgttttgcgctgttaatgcgttacatgatttaggctatacacatagagat
ttaaagccggaaaacttcttaatcgatgccaagggacatataaaattaacagattttggt
ttggctgctggtacgatttctaatgaaagaattgaaagtatgaagataaggttagaaaaa
atcaaggacctggaatttccagcgtttacagagaaatctatagaagatagaagaaaaatg
tacaaccagttgagggagaaggaaattaattatgcgaactccatggttgggtctccggat
tatatggctttggaggttttagaaggaaagaaatatgactttactgtggattactggtcg
ttgggttgtatgctgttcgaaagtttagttggttatacaccatttagtggatcatcgact
aatgagacctatgacaacttaaggcgctggaaacaaactttaagaagaccgagacaatct
gatgggagggcagcattctccgatagaacttgggatttaataacaagattgattgccgat
ccaatcaatcgattaagatccttcgaacatgttaaacgcatgtcttattttgcagatata
aactttagtactttgaggtcaatgatcccgccttttacaccccaactagacagcgaaact
gatgccggttattttgatgacttcaccagtgaggctgacatggccaaatatgctgatgtt
ttcaaaagacaagacaaattaacggctatggtagatgactcggcagtatcatcaaaactt
gttgggttcactttccgacatagaaatggtaaacagggttccagtggcatcttattcaac
ggactggaacactcagaccccttttcaaccttttactag

KEGG   Saccharomyces cerevisiae (budding yeast): YPR111W
Entry
YPR111W           CDS       T00005                                 
Symbol
DBF20
Name
(RefSeq) serine/threonine-protein kinase DBF20
  KO
K06686  cell cycle protein kinase DBF20 [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YPR111W (DBF20)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-
     YPR111W (DBF20)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_C Haspin_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 856227
NCBI-ProteinID: NP_015436
SGD: S000006315
UniProt: P32328
LinkDB
Position
XVI:747306..749000
AA seq 564 aa
MFSRSDREVDDLAGNMSHLGFYDLNIPKPTSPQAQYRPARKSENGRLTPGLPRSYKPCDS
DDQDTFKNRISLNHSPKKLPKDFHERASQSKTQRVVNVCQLYFLDYYCDMFDYVISRRQR
TKQVLRYLEQQRSVKNVSNKVLNEEWALYLQREHEVLRKRRLKPKHKDFQILTQVGQGGY
GQVYLAKKKDSDEICALKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLLYAFQDPE
SLYLAMEFVPGGDFRTLLINTRILKSGHARFYISEMFCAVNALHELGYTHRDLKPENFLI
DATGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERSIEDRRKIYHNMRKTE
INYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLR
YWKKTLRRPRTEDRRAAFSDRTWDLITRLIADPINRVRSFEQVRKMSYFAEINFETLRTS
SPPFIPQLDDETDAGYFDDFTNEEDMAKYADVFKRQNKLSAMVDDSAVDSKLVGFTFRHR
DGKQGSSGILYNGSEHSDPFSTFY
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgttttcacgaagtgatcgagaggtagatgatttggctggtaatatgagtcatttaggg
ttctatgatttgaatattcctaaacctacttctccacaggcgcaatataggcctgctaga
aagagcgaaaatggaagattaactcccggacttccaagatcatataagccgtgtgattca
gatgatcaagataccttcaaaaatcgcatttcattgaatcactcaccgaagaagctaccc
aaggattttcacgagcgtgcttcccaaagtaaaacccagagagttgttaatgtatgccaa
ctttactttctcgactattactgtgacatgtttgattatgttattagcagaagacaacgt
acgaagcaggtgctaagatatcttgaacagcaaagaagtgtcaaaaacgtttctaataag
gttttaaatgaagaatgggctttgtatttgcaaagagaacacgaagtactgagaaaaagg
aggttgaaacctaagcacaaggattttcagatactgacacaagttggacagggtggttat
gggcaagtttatcttgcaaaaaaaaaagacagtgatgaaatttgtgctttgaaaatatta
aacaagaaacttttattcaaactaaacgagacgaatcacgtccttactgagagggacata
ctaaccacaactagatctgactggcttgtgaagttgctttatgcatttcaggatccagag
agcctatatttagcaatggaatttgtacctggtggtgattttcgcacattgttaataaat
acaaggatattgaagagcggtcacgcaaggttctatatcagcgaaatgttttgtgccgtg
aacgcgttgcatgaacttggttacactcaccgggatttaaagccggagaatttcttgatt
gatgctacagggcatatcaagctgaccgattttggtctagcagcagggaccgtatcaaat
gaaagaatcgaaagcatgaaaatacgcttagaagaagtaaagaatttggaatttcctgct
ttcacagaaaggtctatcgaggatagaaggaaaatatatcataacatgaggaagacagaa
attaattacgctaactctatggtcggttcgcctgattatatggccctagaagttctggaa
ggtaaaaaatacgattttacagtggattattggtcattaggctgtatgctttttgaaagt
ttggttggatatacaccttttagtggttcttctactaatgaaacttacgagaatttaaga
tattggaaaaaaactttaagaaggccccgtactgaggatagaagagcagcattctcagat
agaacctgggatttaattacaagactaatagctgaccccatcaacagagtacgatctttt
gagcaagttcgcaaaatgtcttatttcgcagagatcaattttgaaaccctaagaacaagt
tctccaccatttattcctcaattagatgatgaaacggatgcaggttatttcgatgacttc
acaaatgaagaagatatggctaaatatgcagatgtcttcaaaagacagaacaaattatct
gcaatggtcgatgactctgccgttgattccaagcttgttggatttacttttaggcataga
gatggaaaacaaggttcaagcgggatactttacaatggttcagaacattcagaccctttt
tcaactttttattaa

DBGET integrated database retrieval system