KEGG   Saccharomyces cerevisiae (budding yeast): YGR113W
Entry
YGR113W           CDS       T00005                                 
Symbol
DAM1
Name
(RefSeq) Dam1p
  KO
K02307  DASH complex subunit DAM1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGR113W (DAM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YGR113W (DAM1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    DASH complex
     YGR113W (DAM1)
SSDB
Motif
Pfam: DASH_Dam1 Suppressor_APC
Other DBs
NCBI-GeneID: 853010
NCBI-ProteinID: NP_011628
SGD: S000003345
UniProt: P53267
LinkDB
Position
VII:718893..719924
AA seq 343 aa
MSEDKAKLGTTRSATEYRLSIGSAPTSRRSSMGESSSLMKFADQEGLTSSVGEYNENTIQ
QLLLPKIRELSDSIITLDSNFTRLNFIHESLADLNESLGSLLYGIMSNSWCVEFSQAPHD
IQDDLIAIKQLKSLEDEKNNLVMELSNMERGIKRKKDEQGENDLAKASQNKQFNQPLFPS
SQVRKYRSYDNRDKRKPSKIGNNLQVENEEDYEDDTSSEASFVLNPTNIGMSKSSQGHVT
KTTRLNNNTNSKLRRKSILHTIRNSIASGADLPIENDNVVNLGDLHPNNRISLGSGAARV
VNGPVTKNRNSMFSGRAERKPTESRHSVAKKTEKKINTRPPFR
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgagcgaagataaagctaaattagggaccacaaggtctgccacggaatatcgtttatcc
attggtagcgctccgacttcaagaaggtcgtctatgggtgaatcctcatccctgatgaaa
tttgctgatcaagagggattaacgagttccgttggcgaatataacgagaataccatacaa
cagcttctgttgcctaaaataagagaactgagcgattcaatcattactttagattccaat
ttcacgcgcttaaattttatccacgagagtttagctgatcttaatgaatccctaggttcg
ttgttgtacggtattatgagcaattcatggtgcgtagaattctcacaggcgcctcatgat
attcaagacgatttgatcgctattaaacaattgaaatcgttggaagatgagaaaaataac
ttagtaatggaactctccaatatggaacgcgggattaaaagaaaaaaagacgaacaaggt
gaaaatgatttggccaaggcatctcagaacaaacagtttaaccagccgctatttccctcc
tcacaagtaagaaaatacaggtcatatgacaacagagacaagaggaagccctccaagata
ggcaacaacttacaagtagagaatgaggaggactatgaagacgatactagtagtgaagct
tcttttgttctaaatccaacaaatatcggtatgtccaaatcatctcaaggtcacgtgact
aaaaccacgcgtttgaataataataccaacagtaaactgagaagaaagtccatcttacat
acaatcagaaatagcattgcttccggcgctgatttacccatcgaaaacgacaatgttgtt
aatttgggagatctgcatccaaataatcgaatatcactcggaagtggtgctgcaagagtg
gtcaatgggcccgttacgaagaacagaaattcaatgttctcaggacgtgctgaaaggaaa
cccacagaaagcagacattctgttgcaaagaaaactgaaaaaaaaataaatacaaggccc
cccttcagatga

DBGET integrated database retrieval system