KEGG   Saccharomyces cerevisiae (budding yeast): YGR233C
Entry
YGR233C           CDS       T00005                                 
Symbol
PHO81, VAC6
Name
(RefSeq) Pho81p
  KO
K06653  CDK inhibitor PHO81
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGR233C (PHO81)
SSDB
Motif
Pfam: Ank_2 Ank SPX Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 853148
NCBI-ProteinID: NP_011749
SGD: S000003465
UniProt: P17442
LinkDB
Position
VII:complement(954674..958210)
AA seq 1178 aa
MKFGKYLEARQLELAEYNSHFIDYKALKKLIKQLAIPTLKASSDLDLHLTLDDIDEKIIH
QRLQENKAAFFFKLERELEKVNGYYLARESDLRIKFNILHSKYKDYKINGKLNSNQATSF
KNLYAAFKKFQKDLRNLEQYVELNKTGFSKALKKWDKRSQSHDKDFYLATVVSIQPIFTR
DGPLKLNDETLHILLELNDIDNNNRRADIQSSTFTNDDDDDNNTSNNNKHNNNNNNNNNN
NNNNNNNNILHNNYELTTSKISENQLEHLFQASSSSLDMEMEIENWYKEILNIATVKDVQ
RKHALLRNFRETKIFTYLLQNSSESFHKNVFSLLKECLTTLFLLLVASPLDDNSLHIFYK
SNQDHIDLSYCDEDDQVFSRKNVFHEAASCPEKSRLFILDEALTTSKLSKETVQKLLNAQ
DIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLT
IGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKN
KSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAV
RSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEIN
SQSSTQRLNTIDLTPNDDKFDLDIQDSIPDFALPPPIIPLRKYGHNFLEKKIFIKLKLRP
GLESIKLTQDNGIIMSSSPGRITLSSNLPEIIPRNVILPVRSGEINNFCKDISETNDEED
DDEISEDHDDGEIIFQVDSIDDFSMDFEIFPSFGTRIIAKTTAMPFLFKKVAINSIATMN
LPLFDTRLNNIGSLTLDYQIIFPYPGNPLKIINYEPYWKSTGSDLMTSSKDGNFVTSSSL
NGSFISVLVCALNDETIVAAPKPYVEFKGTKILLNDLTKEQLEKVVDYDFGKIDGSFDEV
TLKQYLSSRVVPLRSLLEVIPGSAQLVIRVYFPTDKEIDTIPIKISPFININQFIDKLLL
IIFEHERFLRHSGSGSMRQIVFSSCNWEACSILNWKQPNFPVLLQMKNLLRDSTTGKFVG
DTPNCLKELAVNPQKMSYLNTELINIHTMVQFAMNNNLLGVTLPYEVLKICPSLARIIKQ
NGLLLIASVGENDQIPADGGYSGIYYACELLFENNIDM
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgaaattcggcaagtatttggaagccaggcagttggaactggcggagtacaacagccat
tttattgattataaggctctaaagaaacttatcaaacaattggccattcccacgctaaag
gctagttcagatttagatttgcatttaacattagatgacatcgacgaaaaaattatacat
cagagactgcaagaaaataaagctgcctttttttttaaactagagagggagctggaaaaa
gtaaatggttattatttggcgagagagtccgatttaagaataaaattcaatatattacac
tcaaaatataaagattataagataaatggtaagctaaactcaaaccaagctacctcattt
aaaaacttatatgcggctttcaaaaagtttcaaaaggatcttagaaatttggagcagtat
gttgagttaaataaaacgggattttcaaaagctctgaagaaatgggacaagagatctcaa
tctcacgataaagatttttaccttgctactgttgtttccattcaaccaatttttaccaga
gatgggccactaaaattaaacgatgaaactttacatattctcttagagctgaatgatatt
gacaacaacaatagaagggcagacatacaatccagtacgtttactaatgacgatgatgac
gacaataataccagcaacaataataaacacaataataataataacaataataataacaac
aacaacaacaacaataataataacatattacacaataattatgaattaacaacatcaaag
atttcggaaaaccaacttgaacatctttttcaagcatcttcctcctccttggacatggag
atggaaatcgaaaactggtataaggaaattttgaatatagccacggtgaaagatgttcaa
agaaagcatgcactactaagaaacttcagagaaaccaagatattcacatatctgctacaa
aattcctcagaatcttttcataaaaatgtcttttctttgttgaaggagtgcttaacgacg
ctgtttttattactggtggctagtcctttggacgataactctctgcatattttctataaa
agcaatcaggatcatattgatctgtcatattgtgacgaagatgatcaagtattttcacga
aaaaacgtatttcacgaggctgcaagttgtccagaaaaatcacgcttatttattctagat
gaggctttaacaacatcaaagttatctaaagaaacagtacaaaaactactgaatgcccaa
gatatacattcgcgggtgccgctacattatgctgcagagctaggaaaactggaatttgtt
cactcgttgctaatcaccaatcttttagaggacgttgatcccattgatagtgattctaag
acacccttggttttggctatcactaacaaccacatagatgttgttagggatctgctgact
attggtggtgcgaacgcatcacccattgaaaagccaattctggattatagtaagaatgta
atcagctctactaaagtccagttcgatcctttaaatgttgcttgtaaatttaataatcat
gacgccgccaagttacttttagaaattcggagtaagcaaaatgctgataatgccaagaac
aaaagttcacaacacttgtgtcaaccgcttttcaaaaagaactcaacaggtttatgcact
cttcatatagtggcaaaaattggcggcgatccacaattaattcaactattgatacgttat
ggggcggatcccaacgaaattgatgggtttaataaatggacgcccattttttacgctgtt
cgttcaggtcattctgaagttattactgaactattgaaacataatgcacgtctggatatt
gaagatgacaacggccattcgccacttttttacgccttatgggagagccacgttgatgtt
ttgaatgcacttttacaaagaccattaaatttgccatctgcacccctgaatgaaataaat
tcgcagtctagtacgcaacgccttaatacaatagatttaaccccaaatgatgacaaattt
gatttagacattcaagatagcattccggattttgctttaccaccgccaatcattccacta
aggaaatatggtcataattttttggagaaaaaaattttcatcaaattaaagttgaggcca
ggtctcgagtctatcaagttgactcaggataacggcattattatgtcatcatcaccaggc
agaattactttatcctcaaacttacctgaaataataccgcgaaatgttattttacctgtt
agatctggcgaaattaataacttttgtaaggatatcagtgaaacaaatgatgaagaagat
gatgatgaaattagtgaagatcatgatgatggagagataattttccaagtagattcaatc
gacgatttttcaatggatttcgagatatttccttcatttggcacaaggataattgccaaa
acaacggcaatgccattccttttcaagaaggtggcaataaatagtattgcaaccatgaat
ttacccttattcgacacaagactaaataatattggatctctcactttggattaccaaatt
atttttccttatccgggaaatccactgaaaatcataaattatgagccgtattggaaatct
acaggaagtgatttaatgacctctagtaaagacggtaattttgttacttcttcatcgttg
aatggcagttttattagtgtattagtttgcgctctgaatgatgaaaccatagtggctgcg
ccaaaaccatacgttgaattcaaaggcacgaagattctgttaaatgatttaacgaaagaa
caattggaaaaggtagtggattatgacttcggtaaaattgatggaagcttcgatgaagta
acattgaaacaatacttatcttcgagagtggtgcctctcagaagcctactagaagttatt
cccgggtcagcccagctggtaattcgtgtatattttcctacagataaggaaattgacaca
attcccatcaaaatatcgccatttataaatatcaatcaattcattgataagcttttacta
atcattttcgagcatgaacgttttttgcgtcacagcggaagtgggagtatgcgccaaata
gttttcagttcatgcaattgggaagcttgctcgatccttaactggaaacaacccaatttt
ccggttttgttgcaaatgaaaaatctactcagagattcaaccacaggcaaatttgtaggt
gatactcctaattgtttaaaggaactggccgtaaatcctcaaaaaatgtcgtatttaaac
acggaactaataaacatacatacaatggttcaatttgctatgaacaataatttgttaggt
gtaacgcttccatatgaagtactgaagatatgcccgtcgttggctaggatcatcaaacaa
aacggactactgttgattgcatcggtcggggaaaatgaccaaataccagctgatggaggt
tacagcgggatctactacgcttgtgagttgctttttgagaataatattgatatgtaa

DBGET integrated database retrieval system