KEGG   Saccharomyces cerevisiae (budding yeast): YIL106W
Entry
YIL106W           CDS       T00005                                 
Symbol
MOB1
Name
(RefSeq) Mob1p
  KO
K06685  MOB kinase activator 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    YIL106W (MOB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YIL106W (MOB1)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 854700
NCBI-ProteinID: NP_012160
SGD: S000001368
UniProt: P40484
Structure
LinkDB
Position
IX:join(166415..166434,166520..167444)
AA seq 314 aa
MSFLQNFHISPGQTIRSTRGFKWNTANAANNAGSVSPTKATPHNNTINGNNNNANTINNR
ADFTNNPVNGYNESDHGRMSPVLTTPKRHAPPPEQLQNVTDFNYTPSHQKPFLQPQAGTT
VTTHQDIKQIVEMTLGSEGVLNQAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCS
PQTCPRMIATNEYEYLWAFQKGQPPVSVSAPKYVECLMRWCQDQFDDESLFPSKVTGTFP
EGFIQRVIQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPAD
FGPLLELVMELRDR
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtcttttctacaaaattttcatataagtcccggccaaacaataagatctactagaggt
ttcaagtggaatactgccaatgcagctaataatgcaggctctgtatcgcctactaaggca
actccccataacaatactattaacggcaataataataatgccaatactattaacaataga
gcagattttacaaacaatccagtaaacggatataatgaaagcgaccatggaaggatgtct
cccgtcctcactacgccaaagaggcacgcccctccgcctgaacaattacaaaatgtaacg
gactttaactatacaccatcgcatcagaagccgtttctacaaccgcaagcaggtacgaca
gttacaacacatcaagacatcaagcaaattgtggagatgacactggggtctgagggagtc
cttaaccaagctgtgaagttaccgcgtggtgaggatgagaatgaatggctagcggttcat
tgcgtggatttttacaatcagattaatatgttatacgggtccatcacagaattttgctcc
ccacaaacatgcccgaggatgatagcgacgaacgaatatgaatatctttgggcatttcaa
aagggtcagccccccgtttcggtaagtgcccctaagtatgtggaatgtttgatgaggtgg
tgtcaagaccaatttgatgacgaatctctttttccttccaaagtcaccggtaccttcccg
gagggattcatccaacgagtaattcaaccaattctaaggcgattattcagagtttatgcg
catatttactgtcatcattttaatgaaattcttgaactaaatttacaaaccgtactaaac
acaagttttagacatttttgtctttttgcacaagagttcgaactactaagaccggctgat
tttggtccgctgttagaattagtgatggagttgagggataggtag

DBGET integrated database retrieval system