KEGG   Saccharomyces cerevisiae (budding yeast): YIL148W
Entry
YIL148W           CDS       T00005                                 
Symbol
RPL40A, CEP52A, UB11, UBI1
Name
(RefSeq) ubiquitin-ribosomal 60S subunit protein L40A fusion protein
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YIL148W (RPL40A)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YIL148W (RPL40A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YIL148W (RPL40A)
   04121 Ubiquitin system [BR:sce04121]
    YIL148W (RPL40A)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    YIL148W (RPL40A)
  Archaea
    YIL148W (RPL40A)
Ubiquitin system [BR:sce04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   YIL148W (RPL40A)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 Dsc3_N DUF2604 Sde2_N_Ubi
Other DBs
NCBI-GeneID: 854658
NCBI-ProteinID: NP_012118
SGD: S000001410
UniProt: P0CH08 P0CH09
Structure
LinkDB
Position
IX:join(68708..68715,69150..69528)
AA seq 128 aa
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ
LRPKKKLK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcaaatttttgtcaagactttgactggtaagaccatcactttggaagttgaatcttct
gacactattgacaatgtcaagtcaaagattcaagacaaggaaggtatcccacctgaccaa
caaagattgatctttgctggtaagcaattggaagacggtagaaccttgtctgactacaac
attcaaaaagaatccactttgcacttagtcttgagattgagaggtggtatcattgaacca
tctttgaaagctttggcttccaagtacaactgtgacaaatctgtttgccgtaagtgttat
gctagattgccaccaagagctaccaactgtagaaagagaaagtgtggtcacaccaaccaa
ttgcgtccaaagaagaagttaaaatga

KEGG   Saccharomyces cerevisiae (budding yeast): YKR094C
Entry
YKR094C           CDS       T00005                                 
Symbol
RPL40B, CEP52B, UB12, UBI2
Name
(RefSeq) ubiquitin-ribosomal 60S subunit protein L40B fusion protein
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YKR094C (RPL40B)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YKR094C (RPL40B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YKR094C (RPL40B)
   04121 Ubiquitin system [BR:sce04121]
    YKR094C (RPL40B)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    YKR094C (RPL40B)
  Archaea
    YKR094C (RPL40B)
Ubiquitin system [BR:sce04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   YKR094C (RPL40B)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 Dsc3_N DUF2604 Sde2_N_Ubi
Other DBs
NCBI-GeneID: 853969
NCBI-ProteinID: NP_013020
SGD: S000001802
UniProt: P0CH08 P0CH09
Structure
LinkDB
Position
XI:complement(join(617996..618374,618743..618750))
AA seq 128 aa
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ
LRPKKKLK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcaaatcttcgttaagactttgactggtaagaccatcactttggaagttgaatcttct
gacaccattgacaatgtcaagtccaagatccaagacaaggaaggtatcccacctgaccaa
caaagattgatctttgctggtaagcaattggaagacggtagaactctatctgactacaac
atccaaaaggaatccactttacatttggtcttgagattaagaggtggtatcattgaacca
tctttgaaagccttggcttccaaatacaactgtgacaaatctgtttgtcgtaaatgttac
gccagattaccaccaagagctaccaactgtagaaagagaaagtgtggtcacaccaaccaa
ttgcgtccaaagaagaagttgaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YLL039C
Entry
YLL039C           CDS       T00005                                 
Symbol
UBI4, SCD2, UB14
Name
(RefSeq) ubiquitin
  KO
K08770  ubiquitin C
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YLL039C (UBI4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YLL039C (UBI4)
Ubiquitin system [BR:sce04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   YLL039C (UBI4)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 Dsc3_N DUF2604 NEAT
Other DBs
NCBI-GeneID: 850620
NCBI-ProteinID: NP_013061
SGD: S000003962
UniProt: P0CG63
Structure
LinkDB
Position
XII:complement(64062..65207)
AA seq 381 aa
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGN
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcagattttcgtcaagactttgaccggtaaaaccataacattggaagttgaatcttcc
gataccatcgacaacgttaagtcgaaaattcaagacaaggaaggtatccctccagatcaa
caaagattgatctttgccggtaagcagctagaagacggtagaacgctgtctgattacaac
attcagaaggagtccaccttacatcttgtgctaaggctaagaggtggtatgcagatcttt
gttaagactttgaccggtaaaaccatcactttagaggttgaatcctccgacacgatcgat
aacgttaagtcgaaaatccaggacaaggaaggtatccctccggatcaacagaggttgatc
tttgccggtaagcagctagaagatggtagaaccttgtctgactacaacatccaaaaggaa
tctactcttcacttggtgttgagactgagaggtggtatgcaaatttttgtcaagacactg
acaggtaagactataaccctagaggttgaatcttctgacactatcgacaacgttaagtcg
aaaattcaagacaaggaaggtattcctccagatcaacaaagattgatttttgctggtaag
caactggaagacggtagaacgctgtctgattataacattcagaaagagtctacgttgcat
ttggtgttgagattgagaggtggtatgcaaattttcgtcaaaactctaacagggaagact
ataaccctagaggttgaatcttccgacactattgacaacgtcaaaagtaaaattcaagat
aaagaaggtatccctccggatcaacagagattgatttttgctggtaagcaactagaagat
ggtagaaccttgtctgactacaacatccaaaaggaatctactcttcacttggtgttgaga
ctgagaggtggtatgcaaatttttgtcaagacactgacaggtaagactataaccctagag
gttgaatcttctgacactattgacaacgttaagtcgaaaattcaagacaaggaaggtatt
cctccagaccagcaaagattgatttttgccggtaagcaactagaagatggtagaacgctg
tcggactacaatattcaaaaggagtccactcttcaccttgtcttgaggttgaggggtggt
aactga

KEGG   Saccharomyces cerevisiae (budding yeast): YLR167W
Entry
YLR167W           CDS       T00005                                 
Symbol
RPS31, RPS37, UBI3
Name
(RefSeq) ubiquitin-ribosomal 40S subunit protein S31 fusion protein
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YLR167W (RPS31)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YLR167W (RPS31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YLR167W (RPS31)
   04121 Ubiquitin system [BR:sce04121]
    YLR167W (RPS31)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YLR167W (RPS31)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    YLR167W (RPS31)
  Archaea
    YLR167W (RPS31)
Ubiquitin system [BR:sce04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   YLR167W (RPS31)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YLR167W (RPS31)
  Exosomal proteins of colorectal cancer cells
   YLR167W (RPS31)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 Dsc3_N DUF2604 IBR Fer2_3
Other DBs
NCBI-GeneID: 850864
NCBI-ProteinID: NP_013268
SGD: S000004157
UniProt: P05759
Structure
LinkDB
Position
XII:498947..499405
AA seq 152 aa
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAVLSYYKVDAEGKVTKLRRE
CSNPTCGAGVFLANHKDRLYCGKCHSVYKVNA
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcaaattttcgtcaagactttaaccggtaagactattaccctggaagttgaatcttct
gacactattgacaatgtcaagtccaagatccaagacaaggaaggtattccacctgaccaa
caaagattgatctttgctggtaagcaattggaagatggtagaactttgtccgactacaac
atccaaaaggaatctactctacacttggtcttgagattgagaggtggtggtaagaagaga
aagaagaaggtctacaccaccccaaagaagatcaagcacaagcacaagaaggtcaagttg
gctgtcttgtcctactacaaggtcgatgctgaaggtaaggttaccaaattgagaagagaa
tgtagcaacccaacttgtggtgctggtgttttcttggctaaccacaaggacagattgtac
tgtggtaagtgtcattccgtctacaaggttaacgcttaa

DBGET integrated database retrieval system