KEGG   Saccharomyces cerevisiae (budding yeast): YJL076W
Entry
YJL076W           CDS       T00005                                 
Symbol
NET1, CFI1, ESC5, SRM8
Name
(RefSeq) Net1p
  KO
K06687  nucleolar protein involved in exit from mitosis
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YJL076W (NET1)
SSDB
Motif
Pfam: Cytokin_check_N
Other DBs
NCBI-GeneID: 853369
NCBI-ProteinID: NP_012459
SGD: S000003612
UniProt: P47035
LinkDB
Position
X:295245..298814
AA seq 1189 aa
MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVS
FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLD
PDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSPQSVQPQQQIPSSS
GVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGE
RSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIM
STMTPNRVTLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAVTAQDINRKPPVTTPRI
TSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPYLENGENYESDDSSSSEN
QETPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSN
GESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQVREKEDTNDKLLE
KEILPTIPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEV
DTTVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLNKD
IDNSKPDPRNILPQRTPRSAAKRAAQLLAGAKKNEVPQKSTEDSSSAASTDDESESGIET
DFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVPVKDSKIINKEVDEERNDKRDSQKKSA
VSESSVTNSKISEQMAKSFYPNSNKKQNEATKVETKPATQASSFPVVGGSPSVATKGTTS
FNEEGNRKNVKTKAKNESAQIDRQQKETTSRVADLKSANIGGEDLNKKAEGSKEPEKASA
NIQDANDKNNSKEKEDSKSKQVSQKKLKMTDHLKEGNVQLPKPSANDKLKDLKAKFTNSK
TLVPPGIISNEKNNSSANDDDSSSSGSSTEDESSSSSSSSDEETSTSRKARRVVVNTPRE
PVRSSSKIEAPSPSVNKKINATPDKIPVTQLMDMSSPPSVKSKTTSNPSSILHDLPRKVR
PSLSSLSDLVSRGIPDVKEKTSKSNEKSQTKAPSSSDDESSSDSDSNSSSDSVSDSSSDS
KSESDSDDSGDSSDDGKSFISAKSASAALGKKKKPSGGFASLIKDFKKK
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgtacaagctacaagtggtcttggtgcctccgagtcttcaggcgacgatgccaatacag
tttggctacggaccaaccatcgccgaatcttctcaattgttgccaaacagaactaatatg
gcgcaaagcgccggagatgcctctttgcagtatgctaatctgagatctgccaatgtgagt
ttcacgccaagctatttcaaccagtctaggtttaggaagtttcttttgtttaccaagccg
acaaacacgctgttgaacttgagtgatgaaatcatcgataagtgtgaaaaaatgtacccg
agtttgcaagaagacattgaaattttgagtttgcaagataacagcggttgtgaccttgat
ccggattttttggtaaaggacgttttcaatgtaaataatatcgtaagagttatattgaag
aatgagatagatctggacgattccgcaccagtgtcactttataagtcggtaaaacgatcc
aagttgaacaacgggtcgccccagtcggtgcagccgcaacaacaaatcccgtcctcttca
ggtgttcttcggattgccaagaagaggccacctacaggaaccacgacaacaacaaccatt
cgtagtgccactaatggatccatgagggtttctaccccattggctaggcaaatttatcct
ccaccttcttcgaagatcgtctccaacaactcagatgacgaagacgaagacattggtgaa
agatcctttttgccgcctccaacgcagcctcagtcacctcccataagaattagttcgggc
attgacgcaggtaaaaaaataaaatcaagcatcgtcgaggaagatatcgtgtccagatca
gcaaccgtggatccagataaaacaaagcagcaacgtctattgtccggaactcctataatg
tccaccatgactccaaacagagttactcttaccggtcagagagtggtttctgaacacgca
cataaaaacgaattggttttctctgcttcagcttcttcctcttcatttgctaatggtggc
acagctgctgtcactgctcaggacattaataggaaaccacccgtaaccactccaagaata
acatcaggaatgttgaaaatccccgagccaagaatctcagagattgaaaaagagttaaaa
gagggaccttccagtccggcctccattttacccgctaaagctgcaaagattccaatgaaa
aaaccttacttggaaaatggcgagaactacgaatccgacgatagctcaagtagcgaaaac
caagaaactcctgaaacagaaccacattcaaaggcttccttgcaacgtagtcaaagctcc
atcgcagataataatggctctccggtgaaaaatagtcctctcggtgatgccatgccacac
aatgtgcatttagcagaacttcccaaggcaagcaatacctcgatcaccaaatcttcaaat
ggcgaatcctggggaaagcaacaagaacatcaaccaccaagaaagagttcactggaaact
atagtggaaaagaaatctcaggcggaaccttccggtattgtggaaccgaaaagaatgact
aatttcctagatgataatcaggtaagagaaaaagaagatacgaatgataaacttttagaa
aaggaaattttgccgacaattccacataatgatcagccaatacttgcatcatctgataag
tctaatgggacgttgaaatcactagctgggaaagttagttcaaacaacaacgcttcaaag
gaagatggcactatcattaacggcaccattgaggacgatggcaatgataatgatgaagtt
gatactacggttcgtattgttcctcaagattcagattcctctagtttcccaaagtcagat
cttttcaaaatgatcgaaggtgatgatacagatctaccgcaatggtttaagggcaaaaat
tcgagaacttccggtaattccaaaaattcaaagccttacacaacggttttgaataaagac
atagacaattctaagccagatccaagaaatattttgccccagcgaaccccaagaagtgcg
gctaagagggctgcccaattattggcaggtgccaagaaaaacgaagtcccacagaaaagt
actgaagattctagttcggcagcgtccacagacgatgagtcagagagtgggattgaaaca
gatttctcatcagacgatgattttaaaaggaaaaatatgtcggtgcctaataatgggccc
aaagacatttctttacattctttgaaaggcagtgttgttccagtgaaagactcaaagata
atcaataaagaagttgatgaagaaagaaacgacaaaagagatagtcaaaaaaagtcagcc
gtgagtgaatcttcagtaacaaatagcaaaataagtgaacaaatggcgaaaagcttttat
ccgaattcaaacaagaagcaaaatgaagctacaaaggtggaaactaagccagcaacacaa
gcatcgtcttttcctgttgttggtgggtctccttctgttgctactaaaggaactacctct
ttcaatgaagaaggaaatcgtaaaaatgttaaaacgaaggccaagaatgagtctgcgcag
attgataggcagcagaaggaaacaacttctagggttgcagatttgaaaagcgcaaacata
ggaggtgaagacttgaacaagaaagcagaggggtccaaggaaccagaaaaagcatctgcc
aatatacaggatgctaacgataaaaataactcgaaggaaaaagaagactccaaaagcaaa
caggtatctcagaaaaagttaaaaatgacagatcacttaaaagaaggcaatgttcagctt
cctaagcccagtgcaaatgataaattgaaggatttgaaggctaaatttactaatagtaaa
acactcgtgccacctggaataatttctaatgaaaaaaataattctagtgcaaacgatgat
gattctagctcctcaggttcttccacagaagacgagtctagttcatcttcctcgtcttct
gatgaggaaacttcaacatccaggaaggctagaagagttgttgtaaatacaccaagagaa
ccagttagatcttcatctaagattgaagccccctctccatctgttaacaaaaaaatcaat
gccacccctgataaaattccagttacacagctaatggacatgtcgtctcctccgtcagtt
aaatccaagaccacctcaaatccgtctagtatacttcatgaccttccaagaaaagttcgt
ccttctttgagttcattatctgatcttgtttcaagaggcatcccagatgtaaaggaaaaa
acttctaaatcgaatgagaagtcacaaacaaaagccccttcaagtagtgatgatgaatct
agctctgattctgactctaactccagttcggactccgtatcggattccagttcagattct
aaatctgagtcagattctgatgactcaggggattcatctgatgatggaaaaagttttatt
agtgcgaaatccgctagtgctgctttaggtaagaagaagaagccaagtggtggatttgca
tcattaataaaagatttcaagaaaaaatga

DBGET integrated database retrieval system