KEGG   Saccharomyces cerevisiae (budding yeast): YJL092W
Entry
YJL092W           CDS       T00005                                 
Symbol
SRS2, HPR5
Name
(RefSeq) DNA helicase SRS2
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    YJL092W (SRS2)
   03430 Mismatch repair
    YJL092W (SRS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJL092W (SRS2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     YJL092W (SRS2)
DNA repair and recombination proteins [BR:sce03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     YJL092W (SRS2)
   MMR (mismatch excision repair)
    Other MMR factors
     YJL092W (SRS2)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 AAA_11 Helicase_RecD
Other DBs
NCBI-GeneID: 853353
NCBI-ProteinID: NP_012443
SGD: S000003628
UniProt: P12954
Structure
LinkDB
Position
X:257423..260947
AA seq 1174 aa
MSSNNDLWLHLVSQLNTQQRAAALFDYTRGLQVIAGPGTGKTKVLTSRVAYLILHHHIHP
RDIIVTTFTNKAANEMKERLQEMLRGAGVNISELLIGTFHSICLKILYRFGHLVDLQKDW
RIIDEKEIDVILDDMIEKVPDQIRDYASSITRKVNLCMPSKNGDEWTIHPKLIKKQISKL
KSNAILPEEYILDSNHDAALGYFYQIYQSELSKKNTLDFDDLLMYTFRLLTRVRVLSNIK
HVLVDEFQDTNGIQLDLMFLFAKGNHHLSRGMTIVGDPDQSIYAFRNALAHNFLEMGRKC
PIEYSTIILVENYRSSQKILNTSEILITQQNKGRQNRAPLRAQFDLDFPPVYMNFPAYFL
EAPSLVRELLYLKALPNLFTFNDFAILVRQRRQIKRIESALIEHRIPYKIIRGHSFWDSK
ETRAMLNLLKLIFSPNDKHAILASLLYPARGLGPATGEKIKNALDTLATDVSCFQILKDI
SSKKIMLDIPTKGRSVIADFISMIENCQLLLQSTLLGGLSDLFDKLYELSGLKYEYLYKD
GKKKNDQLEKSEPNLLNARHKNIELLKNYFLALLSKSESSDKEKNEAIKAATDEAEPIEN
KVITPKEYLRNFFNSLSLHSDAAEEEESESNKDAKIKREKNGFVTISTIHGAKGLEWPVV
FIPGCEEGIIPCVFNDDKKDESEEDEEEDQENSKKDASPKKTRVLSVEDSIDEERRMFFV
AQTRAKYLLYLSNTVTVEDVDRPRIASRFLTTDLIKAMSDSQKLFESTNSIKKLYRILNK
KPPAEDDKLFSLDQLRKDYNQFIENRRERMIWQGIQMNDVYGIQLSRNKLLGSVSDFTSA
ADQLRLETQNSIFPQKKLIEKSRPSKINGNYAPKSRVKSPEKRYAPETTSFHSPTKKKVY
APQYVSTTNVPSRQEFHSSTGKNIPFLRREDRSITDISPRSSTRSLKGASPNKTSHMSDD
LMRPSPTRKDKVTRNIHFATAGTFRIETQSNVDELHPPEYSNKSGQSLTSSEFSGFSSAC
SNSDQPTNLIEDINNELDLSDEELLNDISIERRRELLGSKKTKKIKPKTRNRKSKRGDKV
KVEEVIDLKSEFEEDDSRNTTAAELLHNPDDTTVDNRPIISNAKFLADAAMKKTQKFSKK
VKNEPASSQMDIFSQLSRAKKKSKLNNGEIIVID
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgtcgtcgaacaatgatctttggttgcatttagtatcccagttaaatactcaacagaga
gcagcggccctctttgattacactagagggctgcaggtcattgccggtcccggcacaggg
aagactaaggttttaacttcaagagtagcgtatcttattctgcaccaccatattcatccc
cgcgatattatagtgactactttcactaacaaagctgctaacgaaatgaaagagcgtttg
caagaaatgttacgcggggcaggcgtgaatatttcggagctcttaattggtacttttcat
agtatttgcctgaaaatactttatagatttggccacttggtggatctacagaaagactgg
agaattattgatgagaaggaaatagatgtcattttagatgatatgatcgaaaaagttccc
gaccaaataagggattatgcttcctcaatcacaaggaaagtaaatctttgtatgccgagt
aaaaatggagatgaatggactattcatccgaagctgatcaagaaacagatatcaaagcta
aaatcaaacgcaatattacctgaggaatacatcttagattcgaatcatgacgccgcgctt
ggttacttttaccaaatataccaatcagagctaagcaagaaaaatacgttagattttgat
gacttattaatgtacacctttcgtttgctgactagagtgcgtgttttatccaacataaag
catgttttagttgacgaatttcaagatactaacggcattcaattggacttgatgtttctt
tttgctaagggaaatcatcatctttcgagggggatgaccatcgtaggtgatcctgatcaa
agcatatatgctttcagaaacgccttagcgcacaactttctagaaatgggcagaaaatgt
cccatcgagtactcaactatcatacttgttgaaaattatcgttcatcacaaaaaattcta
aatacaagcgaaattttaataacgcaacaaaacaaaggtcggcagaatagggctccactc
cgtgcccaatttgacctggattttccaccagtttacatgaatttccccgcttactttttg
gaagcaccttctttagttcgggaactactatatttgaaggcattgccaaacctattcaca
tttaatgactttgctatcctagtaagacaacgaagacaaattaaaaggatcgaaagtgca
ttaatagaacatcggataccctataaaattattaggggccacagtttctgggattccaag
gaaacaagagcgatgttaaatttattaaaattgatattttctccgaatgacaaacatgca
attcttgcttcacttttatatccagcaaggggccttggtcctgctaccggtgagaagatt
aagaacgcattggacacgttagctaccgatgtgtcatgtttccaaatattgaaagacata
agtagtaaaaaaataatgctagacataccgacgaaaggccgttctgtgattgctgacttc
atttcaatgatagaaaattgtcaattgttgctccagagcactttactagggggtctttca
gatttatttgataagctatatgaattatcaggtctgaaatacgaatacttgtacaaggat
ggtaagaaaaaaaatgatcagcttgaaaaatccgaacctaatttattaaacgcaagacat
aagaatattgaacttttgaaaaactatttcctggctcttctttccaagtcagaatcttca
gataaagaaaaaaatgaagccattaaagcagcaacagatgaagccgaaccaatagagaac
aaggtcatcactccaaaagaatacctccgtaatttcttcaattcactttcccttcattct
gatgcagctgaggaggaagagtcggaatccaataaagatgcaaaaataaaacgtgagaag
aatgggtttgtcacgatatctacaattcacggtgccaaaggtcttgagtggccggtagtt
tttattcctggatgcgaagaaggtataattccttgtgtgttcaacgatgataagaaagac
gaatcagaggaggacgaagaagaagatcaagaaaatagtaagaaagatgcaagcccaaaa
aagactagagttttatccgtggaagattctatagatgaggaaagaagaatgttttttgtt
gcacagactcgtgcaaaatacctgttgtacctatcaaatactgtaactgtggaagatgtc
gatagaccaagaattgcaagccgatttttgactactgacttgataaaagccatgtccgat
agccaaaaattatttgaaagtacgaatagtatcaaaaaactataccgaattttgaacaaa
aagccgcctgctgaagatgataaactattctcccttgaccaattgcgcaaagactataac
caattcattgaaaataggagagaaaggatgatttggcaagggatacaaatgaatgatgtc
tatggaatacagttgtctagaaataaattattgggttctgttagtgatttcacgtcagct
gcggaccagttacgactcgaaacgcaaaactctatattcccacagaagaaacttattgaa
aaatcacgcccatccaaaatcaatggcaattacgctcctaaaagtagagttaaaagtcca
gaaaaaaggtacgctccagaaactacatcattccattctcctacaaagaaaaaggtgtat
gcacctcaatacgtttcaacaactaatgtacctagtaggcaggagtttcattcttctact
gggaaaaatattccttttctgagaagagaagataggtccatcacagacatatcaccacga
tcatcaacgaggtcgttaaaaggagcatctccaaataagacgagccacatgtcagatgat
ttaatgagaccatcacctacgaggaaggacaaagttactcgtaatattcatttcgcaact
gcaggaactttcagaatagaaacccagtcaaatgttgatgaactgcatcctccggaatac
tccaataaatcagggcagtcgcttacgtcgagtgaattttctgggttttctagcgcgtgc
agtaattctgatcagccaacgaacttaatagaagatataaacaacgaattagatctatcc
gatgaggagttattaaatgacatatcaatagaaaggaggagagagcttttgggctcgaaa
aagacgaaaaaaataaaaccaaaaactcgaaatagaaagtctaagagaggtgacaaggtt
aaggtggaggaagtgatagatttgaagagtgaatttgaggaagatgacagcagaaataca
acagctgctgagttattacataatccggatgacactacagttgacaatcgtccaataatc
tccaatgctaagtttttggctgacgcagcaatgaaaaagacacagaaattttccaaaaag
gtgaagaatgaacctgcatcaagtcaaatggatatattttctcagctgtcacgtgcgaaa
aaaaagtcaaaattaaacaacggtgaaatcatagtcatcgattag

DBGET integrated database retrieval system