KEGG   Saccharomyces cerevisiae (budding yeast): YJR035W
Entry
YJR035W           CDS       T00005                                 
Symbol
RAD26
Name
(RefSeq) DNA-dependent ATPase RAD26
  KO
K10841  DNA excision repair protein ERCC-6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    YJR035W (RAD26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YJR035W (RAD26)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJR035W (RAD26)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    YJR035W (RAD26)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      YJR035W (RAD26)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII
Other DBs
NCBI-GeneID: 853492
NCBI-ProteinID: NP_012569
SGD: S000003796
UniProt: P40352
Structure
LinkDB
Position
X:497355..500612
AA seq 1085 aa
MEDKEQQDNAKLENNESLKDLGVNVLSQSSLEEKIANDVTNFSNLQSLQQEETRLERSKT
ALQRYVNKKNHLTRKLNNTTRISVKQNLRDQIKNLQSDDIERVLKDIDDIQSRIKELKEQ
VDQGAENKGSKEGLQRPGETEKEFLIRTGKITAFGHKAGFSLDTANREYAKNDEQKDEDF
EMATEQMVENLTDEDDNLSDQDYQMSGKESEDDEEEENDDKILKELEDLRFRGQPGEAKD
DGDELYYQERLKKWVKQRSCGSQRSSDLPEWRRPHPNIPDAKLNSQFKIPGEIYSLLFNY
QKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPATVMKQ
WCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRT
KKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSE
ISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYA
NATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEF
LHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDTKRHNPDYGDPKRSGKMQVVKQLL
LLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFNN
ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVSIYRLMV
GGSIEEKIYHRQIFKQFLTNRILTDPKQKRFFKIHELHDLFSLGGENGYSTEELNEEVQK
HTENLKNSKSEESDDFEQLVNLSGVSKLESFYNGKEKKENSKTEDDRLIEGLLGGESNLE
TVMSHDSVVNSHAGSSSSNIITKEASRVAIEAVNALRKSRKKITKQYEIGTPTWTGRFGK
AGKIRKRDPLKNKLTGSAAILGNITKSQKEASKEARQENYDDGITFARSKEINSNTKTLE
NIRAYLQKQNNFFSSSVSILNSIGVSLSDKEDVIKVRALLKTIAQFDKERKGWVLDEEFR
NNNAS
NT seq 3258 nt   +upstreamnt  +downstreamnt
atggaagataaagagcagcaagacaatgcgaaacttgaaaacaatgagtcactaaaagat
ctgggagttaacgtgctttcccaaagcagtttggaggaaaaaatagctaatgatgtaact
aactttagcaacctacaatcgctgcagcaagaagagactcgtctagaacggagtaagacc
gctctgcaacgttatgtcaataagaagaatcatctcacaaggaagttgaacaataccact
aggatatctgttaagcagaatctccgagaccagatcaagaacttacaatcagacgatatt
gaacgagttctgaaggacatagacgatatccaatcaaggattaaagagttgaaagagcag
gtagatcaaggtgctgaaaataaaggttccaaagaggggctgcagagacccggtgaaact
gagaaggagtttttaatcaggactggtaagatcactgcatttggacacaaggctggtttc
agcttggacactgcaaacagagagtatgccaagaatgacgaacaaaaagatgaggatttt
gaaatggcaacagaacaaatggtagaaaatttaacggatgaggatgacaatctcagcgat
caagactatcaaatgagtggtaaagagagtgaagatgacgaagaagaagaaaatgacgat
aaaattctcaaagaactggaagacctgcggttcagaggccaacctggtgaggcgaaggat
gatggggacgagttgtattatcaagaaaggttaaaaaaatgggtgaaacaacgttcttgc
ggtagtcaaaggtcatcggacttgccagaatggcgaagacctcatccgaatattcccgac
gcaaaacttaatagccagttcaaaatacccggtgaaatatactcgctgttatttaattac
caaaagacgtgcgttcagtggctctatgagctttaccagcagaactgtggcggtattatt
ggtgacgaaatgggtctgggaaaaacgattcaagttatcgcatttatcgcagcgttgcat
cattcaggtctattaacaggccctgtattaattgtctgtcctgcaactgtgatgaagcaa
tggtgtaatgagttccagcattggtggcctccattgaggacggtcatattgcactcaatg
ggttcaggaatggcttctgaccaaaaatttaagatggatgaaaacgatctagagaacttg
ataatgaattcaaagccaagtgatttttcttacgaggattggaagaactcaacaaggaca
aagaaggcattggaatcaagctatcatttagataagttgatagataaagtcgttactgat
gggcacattttaattaccacgtacgttgggttaagaatacattcagataagctactaaaa
gttaaatggcagtatgctgttttagatgagggacataagattagaaacccagattcggag
atttcattgacttgcaaaaaactgaagacacataataggatcattctttcaggaacaccg
atacagaataatttaaccgagctttggtcgctttttgatttcattttccctggtaaatta
ggaactctacctgtgtttcaacaacagtttgtcatacctataaatattggtggttatgca
aacgcaacaaacatacaagttcagaccggctacaaatgtgctgttgcattgcgtgacttg
atttcaccgtacctgttacgtcgtgtgaaagctgatgttgcaaaagatctgccacaaaag
aaagaaatggttctcttttgtaagcttacgaaatatcaaagaagcaaatatttggagttt
ctgcattcttcagatttaaaccaaatacaaaacggtaagagaaatgttctatttggtatc
gacattctaaggaaaatatgtaatcaccccgatttacttgacagagatacaaagagacat
aatccagattacggtgatcctaaaagatccggaaaaatgcaggttgtcaagcaattatta
ttactgtggcataagcagggctataaagccctactcttcactcaatcgagacaaatgctc
gatattctagaggagtttatatcaacgaaagatcccgatttatcacatttgaactaccta
cgaatggatgggacaactaatatcaaagggagacagtcgttagttgaccggtttaacaat
gaatctttcgatgtattcttactaaccacaagagttggggggctaggtgttaatttaacc
ggtgctaatagaattatcatttttgatccagactggaacccatctactgacatgcaagct
cgagaaagggcatggaggattgggcagaaaagagaggtatcaatatataggttgatggta
ggaggttcaatagaggagaagatttatcatagacaaatattcaaacaattcttaaccaac
aggattttgactgatcctaagcagaaacgatttttcaaaattcacgaactccatgatctg
ttttcactggggggtgaaaacggttattctacagaagaattgaacgaagaagttcaaaaa
cataccgaaaatttaaaaaattccaaatcagaggaaagtgacgattttgaacaactggtc
aacctatctggcgtatctaaactagaaagcttttataacggtaaggaaaaaaaagagaat
agtaaaacagaggatgatagattaatcgaagggttgctaggaggagagagcaatttagaa
accgttatgagtcatgattcggttgtcaattcgcacgcgggcagttcttcttcgaatata
attacaaaagaggcttccagagtagcgattgaggcggttaatgcgctaaggaaatcgaga
aaaaagatcactaagcaatatgaaattgggacacctacttggacaggtaggtttggtaaa
gcaggtaaaattagaaagagagatccgttgaaaaataaattaactggatcagctgccatt
ttaggcaatattacaaaatcacaaaaagaggcatccaaggaagctcgccaagaaaattac
gacgatggtataaccttcgcaagatccaaggaaatcaattccaataccaaaacgctagaa
aatattcgggcatatttacagaaacagaataactttttctcatctagtgttagcatactt
aacagcattggcgtcagtctttctgataaagaagacgttattaaggttagagcattatta
aaaaccatagcacagtttgataaagagcgtaaagggtgggtgcttgatgaagaatttagg
aataacaatgcttcatga

DBGET integrated database retrieval system