KEGG   Saccharomyces cerevisiae (budding yeast): YJR053W
Entry
YJR053W           CDS       T00005                                 
Symbol
BFA1, IBD1
Name
(RefSeq) Bfa1p
  KO
K02181  cell cycle arrest protein BFA1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YJR053W (BFA1)
SSDB
Other DBs
NCBI-GeneID: 853513
NCBI-ProteinID: NP_012587
SGD: S000003814
UniProt: P47113
LinkDB
Position
X:534027..535751
AA seq 574 aa
MSIRPLTLNGLDEPETSFEELNTTLPRFQSHETLTLEENVPPLSTSTYIPPPSSVGTSDT
GTVFSNSTSAFWSNKQADDDQDMEVDQDDEFLNDFQEFQNKKDDFDDAIKTNFHLRNGCR
TGPFKNDIFAEEFDRKLSLEDKPRLKQPRSMMELKPKRKLSNSVTSRNLRSGNSVRFKKS
MPNLALVNPAIREEEEDEEREREDQREFNYKIDNDTQDTILAKFSSDDEGDFLTGFEELE
GEAIDETISSNDKESADHPRFLKKSSSSLPLKISPAQYDIVKHDELLTPGLHRRQRDWNT
QQELDSFKEKRSVRHCSNQNVQLNGPAKIKTIKQQIDHNTPMKKGSMIYNPKTMKWEGNE
NVLSKFSDVDTANRKALLIKNKLQRDADSKKQKYSDLQHARATSRNQKVIGNMILDEQNL
RWVSVSEEEADPFAGIPEINLPPVGKSMKKRSSSPFLRSKSQVNTPFVSNDNDGVYQSTA
AQARLRKYHSMRTLNGTTETPEISSTFHLSSRALEKFYHEENRWCKKLASWFIPRDETII
SVDEETIMDESTVNSKRKSYMYEIRNMVINSTKD
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgtcaattaggcctctcacgttaaacggtttagatgagccagaaacctcttttgaagaa
ctgaatacaactctacctcgctttcaatcccatgaaacattaactttggaagaaaacgtg
ccaccattgagtacatcaacttatataccgcctccatcctcggtaggtacttctgacact
ggcacggtattttccaatagtaccagcgcgttttggtctaataagcaagcagacgatgat
caggacatggaggtagaccaggatgatgaatttctaaatgacttccaggaattccaaaat
aaaaaggatgattttgacgatgctattaaaacaaattttcatttgagaaatggatgtcga
actggccctttcaaaaacgacattttcgcagaagagtttgatagaaaactgagtttggaa
gataaaccaaggctaaagcaacctagatcaatgatggaattgaaaccaaaaagaaaacta
tcaaatagcgtcacttcaagaaacttaaggtctggtaattctgtaagatttaagaaatct
atgcctaacttagctttagttaatccagctatcagagaagaagaagaggacgaagaacga
gaaagagaagatcaacgagagtttaattacaagattgataacgatacgcaggacacaatt
ttggcgaaattcagttcagatgatgaaggtgactttctgacaggatttgaagaattagag
ggtgaagcaattgatgaaacgatttcttcgaacgataaagaaagtgccgaccatccgcgt
ttcttaaagaagtcatcctcatctttgccattaaaaatatcacctgcacaatatgatata
gtaaagcatgacgaattattaactccaggtcttcataggcgacaacgagattggaatacc
cagcaggaactggactcttttaaagaaaaacgatcagtaagacactgttctaatcaaaat
gtacaactcaatggtccagctaaaatcaaaacaataaaacagcaaattgatcataatact
ccaatgaagaaaggttctatgatatataacccgaaaactatgaagtgggaaggaaatgaa
aacgtcttaagcaaatttagtgatgtagacacggcaaacaggaaagctttattgataaaa
aacaagctacaacgagatgcagattctaagaagcaaaaatattctgatctacagcatgca
agagccacttcgagaaatcaaaaggtcatcgggaacatgattttagatgaacaaaattta
agatgggttagtgtttcagaggaagaagcagacccttttgcaggcattcctgagataaac
ttaccaccagttggcaaaagtatgaaaaaacgtagctcctcaccatttttgcgttccaaa
agccaagttaatacgccatttgtttcaaatgacaatgatggcgtttatcaaagtacggct
gctcaagcaagactccgtaaataccattcaatgaggacacttaacggtacaacagaaact
ccagaaataagctctactttccatttgagttcaagagcattggaaaaattttaccacgag
gagaacaggtggtgtaaaaagttagcctcatggtttataccccgagatgagaccattatc
agtgttgatgaggaaacaatcatggatgaaagtacggtcaatagcaagagaaaatcctat
atgtatgaaatcaggaacatggtaatcaattcgacaaaagattag

DBGET integrated database retrieval system