KEGG   Saccharomyces cerevisiae (budding yeast): YJR090C
Entry
YJR090C           CDS       T00005                                 
Symbol
GRR1, CAT80, COT2, RMR3, SDC1, SSU2
Name
(RefSeq) SCF ubiquitin ligase complex subunit GRR1
  KO
K03360  F-box and leucine-rich repeat protein GRR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YJR090C (GRR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YJR090C (GRR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YJR090C (GRR1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     YJR090C (GRR1)
SSDB
Motif
Pfam: F-box-like F-box
Other DBs
NCBI-GeneID: 853552
NCBI-ProteinID: NP_012623
SGD: S000003850
UniProt: P24814
LinkDB
Position
X:complement(590872..594327)
AA seq 1151 aa
MDQDNNNHNDSNRLHPPDIHPNLGPQLWLNSSGDFDDNNNNNNNNNNNNSTRPQMPSRTR
ETATSERNASEVRDATLNNIFRFDSIQRETLLPTNNGQPLNQNFSLTFQPQQQTNALNGI
DINTVNTNLMNGVNVQIDQLNRLLPNLPEEERKQIHEFKLIVGKKIQEFLVVIEKRRKKI
LNEIELDNLKLKELRIDNSPQAISYLHKLQRMRLRALETENMEIRNLRLKILTIIEEYKK
SLYAYCHSKLRGQQVENPTDNFIIWINSIDTTESSDLKEGLQDLSRYSRQFINNVLSNPS
NQNICTSVTRRSPVFALNMLPSEILHLILDKLNQKYDIVKFLTVSKLWAEIIVKILYYRP
HINKKSQLDLFLRTMKLTSEETVFNYRLMIKRLNFSFVGDYMHDTELNYFVGCKNLERLT
LVFCKHITSVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQGFYVPQARNVT
FDSLRNFIVHSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLL
TRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPK
LRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFAC
CTNLTNRTLYELADLPKLKRIGLVKCTQMTDEGLLNMVSLRGRNDTLERVHLSYCSNLTI
YPIYELLMSCPRLSHLSLTAVPSFLRPDITMYCRPAPSDFSENQRQIFCVFSGKGVHKLR
HYLVNLTSPAFGPHVDVNDVLTKYIRSKNLIFNGETLEDALRRIITDLNQDSAAIIAATG
LNQINGLNNDFLFQNINFERIDEVFSWYLNTFDGIRMSSEEVNSLLLQVNKTFCEDPFSD
VDDDQDYVVAPGVNREINSEMCHIVRKFHELNDHIDDFEVNVASLVRVQFQFTGFLLHEM
TQTYMQMIELNRQICLVQKTVQESGNIDYQKGLLIWRLLFIDKFIMVVQKYKLSTVVLRL
YLKDNITLLTRQRELLIAHQRSAWNNNNDNDANRNANNIVNIVSDAGANDTSNNETNNGN
DDNETENPNFWRQFGNRMQISPDQMRNLQMGLRNQNMVRNNNNNTIDESMPDTAIDSQMD
EASGTPDEDML
NT seq 3456 nt   +upstreamnt  +downstreamnt
atggatcaggataacaacaaccacaatgacagcaataggctgcacccacctgatatacat
ccaaatttgggccctcaattgtggctgaatagtagcggtgattttgacgacaacaacaac
aacaacaacaacaacaacaataataatagcacaagaccacaaatgccatcacgaactaga
gaaacggcaacttcggaaagaaatgcaagtgaggttagggatgcaacgctaaataatatc
tttaggttcgatagtattcaacgggaaacgcttttgccaaccaacaacggacaaccgcta
aatcaaaacttttcgctgacatttcaaccacaacagcaaacaaatgcgctgaacgggatt
gacataaacactgtgaacacaaaccttatgaatggtgtcaatgttcaaatagatcaactt
aatcgattgttaccgaacctaccagaggaagaacggaagcaaatccacgaattcaagcta
atagtgggcaaaaaaatccaagagtttctggttgttatagagaaacgtagaaaaaaaata
ctgaacgaaattgagctagacaaccttaaactaaaggagctacgtattgataactcccca
caagcaattagttatttgcataaattacaaagaatgaggcttagggcgctagagacagaa
aacatggaaattagaaatttaaggctaaaaatattaacaattatagaagagtacaaaaag
tcattatatgcatactgccattccaagctaagaggtcaacaagtggaaaatccaacagat
aatttcatcatttggataaactccatagatactactgaatcatctgacttgaaagaaggg
ctacaagatctttcgagatattcaaggcagttcataaataatgtgctttcgaatccatca
aatcaaaacatatgtacgagtgtcacccgaagatcacctgtgtttgccctaaacatgcta
ccctcggaaatattacacttaatattagataaacttaaccaaaaatatgatattgtaaaa
ttccttaccgtttccaaactctgggctgaaataattgtgaagatactttattacagaccg
cacatcaacaaaaagagtcaattagacttgtttttaaggactatgaagttaacttctgaa
gaaactgtattcaactatcgtttaatgatcaaaagattaaatttttcatttgttggtgac
tacatgcacgatacagagcttaactattttgtcggatgtaagaatttggagcgactaact
ttagtattttgcaagcatataaccagtgttccaatatcggctgttttgagaggatgtaaa
tttctccaaagtgtggatatcactggaataagagacgtttccgatgacgtatttgatacc
ttagcgacatattgtcccagagtacagggcttttatgttcctcaggcaaggaatgtaaca
ttcgattcactgcggaatttcatagtccattccccgatgttgaaaagaataaaaatcaca
gcaaacaataacatgaatgacgaattagtagaactattagccaacaaatgccctttgctt
gtagaggtcgatataacattaagtccaaatgtcactgattctagtttgttaaaactcctc
actaggttagttcagctgagggaattcagaataactcataatacgaatattacggataat
cttttccaggagctttctaaagtagttgacgatatgccctctttaagattgattgatctt
tctggatgtgaaaatattacagataaaactatagaaagtatagtcaatttagcccctaaa
ttacgtaatgtttttctaggcaagtgtagccgaattacagatgcatcgttgttccaatta
tcgaagctgggcaaaaacttgcaaacagtgcattttgggcactgtttcaatataactgat
aacggggtaagagcactctttcattcatgtacaagaatacagtatgtggactttgcgtgc
tgtacgaatttaaccaatagaactctttatgaactagcagacttaccaaaattaaagaga
attggccttgtcaaatgtacgcaaatgactgacgagggtttgttgaatatggtttccttg
cgaggccgaaatgatactttagaaagggtacatttatcttactgttctaatttaacaata
tatccgatatatgagcttctaatgtcttgcccaaggctctcacatttgtctttgactgct
gttccgtcatttttacgccccgatataacgatgtattgcaggcctgcaccctcagacttt
agtgaaaatcaacgtcaaatattctgcgtattttcagggaaaggtgttcataaacttcgc
cattatttagtaaatttaacgtcgcccgcttttggaccacatgtcgatgtaaatgatgtt
ttgacaaaatatattagatccaagaatttgatatttaacggtgaaacacttgaagatgct
cttaggagaatcataactgatttaaatcaagattccgctgcaattatagctgctacagga
ttaaatcaaatcaacggtctaaataacgattttcttttccagaatatcaattttgaacga
atagatgaagtattcagttggtatctcaatacttttgatggcattaggatgagctcggag
gaagttaactcactattattgcaagtaaacaagacgttttgtgaagatccatttagtgat
gtggacgatgatcaagattatgtcgtagcacctggtgtaaaccgggaaattaacagtgaa
atgtgtcatattgttagaaaattccatgagttaaatgatcatattgatgatttcgaggtg
aatgttgctagtttggtaagagttcagtttcagtttactggttttttacttcatgaaatg
actcaaacctatatgcaaatgattgaattaaacagacaaatttgtttagtacaaaaaacg
gttcaggaatcgggcaacatagattaccaaaaagggcttttaatatggcgacttttattc
attgacaaattcattatggtggttcagaagtacaagctctccaccgttgttttgagacta
tatttaaaagataacataacattgttaaccagacaaagagaactattaatagcccaccaa
agatcagcatggaataacaataatgacaatgacgccaaccggaacgccaacaacatagtg
aatattgtatcggatgctggggcaaacgatacaagtaacaatgaaactaacaatggtaat
gatgacaatgaaacagaaaatccaaatttctggcgtcagtttggcaatagaatgcaaata
tcacctgaccagatgaggaatctccaaatgggacttcgtaatcagaacatggttaggaac
aataacaacaacacaattgacgaatcaatgcctgacactgccattgattctcaaatggat
gaagcatcaggaacgcccgatgaagatatgttataa

DBGET integrated database retrieval system