KEGG   Saccharomyces cerevisiae (budding yeast): YKL010C
Entry
YKL010C           CDS       T00005                                 
Symbol
UFD4
Name
(RefSeq) putative ubiquitin-protein ligase UFD4
  KO
K10590  E3 ubiquitin-protein ligase TRIP12 [EC:2.3.2.26]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YKL010C (UFD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YKL010C (UFD4)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     YKL010C (UFD4)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  HECT type E3
   YKL010C (UFD4)
SSDB
Motif
Pfam: HECT
Other DBs
NCBI-GeneID: 853859
NCBI-ProteinID: NP_012915
SGD: S000001493
UniProt: P33202
LinkDB
Position
XI:complement(421424..425875)
AA seq 1483 aa
MSENNSHNLDEHESHSENSDYMMDTQVEDDYDEDGHVQGEYSYYPDEDEDEHMLSSVGSF
EADDGEDDDNDYHHEDDSGLLYGYHRTQNGSDEDRNEEEDGLERSHDNNEFGSNPLHLPD
ILETFAQRLEQRRQTSEGLGQHPVGRTLPEILSMIGGRMERSAESSARNERISKLIENTG
NASEDPYIAMESLKELSENILMMNQMVVDRIIPMETLIGNIAAILSDKILREELELQMQA
CRCMYNLFEVCPESISIAVDEHVIPILQGKLVEISYIDLAEQVLETVEYISRVHGRDILK
TGQLSIYVQFFDFLTIHAQRKAIAIVSNACSSIRTDDFKTIVEVLPTLKPIFSNATDQPI
LTRLVNAMYGICGALHGVDKFETLFSLDLIERIVQLVSIQDTPLENKLKCLDILTVLAMS
SDVLSRELREKTDIVDMATRSFQHYSKSPNAGLHETLIYVPNSLLISISRFIVVLFPPED
ERILSADKYTGNSDRGVISNQEKFDSLVQCLIPILVEIYTNAADFDVRRYVLIALLRVVS
CINNSTAKAINDQLIKLIGSILAQKETASNANGTYSSEAGTLLVGGLSLLDLICKKFSEL
FFPSIKREGIFDLVKDLSVDFNNIDLKEDGNENISLSDEEGDLHSSIEECDEGDEEYDYE
FTDMEIPDSVKPKKISIHIFRTLSLAYIKNKGVNLVNRVLSQMNVEQEAITEELHQIEGV
VSILENPSTPDKTEEDWKGIWSVLKKCIFHEDFDVSGFEFTSTGLASSITKRITSSTVSH
FILAKSFLEVFEDCIDRFLEILQSALTRLENFSIVDCGLHDGGGVSSLAKEIKIKLVYDG
DASKDNIGTDLSSTIVSVHCIASFTSLNEFLRHRMVRMRFLNSLIPNLTSSSTEADREEE
ENCLDHMRKKNFDFFYDNEKVDMESTVFGVIFNTFVRRNRDLKTLWDDTHTIKFCKSLEG
NNRESEAAEEANEGKKLRDFYKKREFAQVDTGSSADILTLLDFLHSCGVKSDSFINSKLS
AKLARQLDEPLVVASGALPDWSLFLTRRFPFLFPFDTRMLFLQCTSFGYGRLIQLWKNKS
KGSKDLRNDEALQQLGRITRRKLRISRKTIFATGLKILSKYGSSPDVLEIEYQEEAGTGL
GPTLEFYSVVSKYFARKSLNMWRCNSYSYRSEMDVDTTDDYITTLLFPEPLNPFSNNEKV
IELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDP
LLAKSLKYIVANKDDNMTLESLSLTFTVPGNDDIELIPGGCNKSLNSSNVEEYIHGVIDQ
ILGKGIEKQLKAFIEGFSKVFSYERMLILFPDELVDIFGRVEEDWSMATLYTNLNAEHGY
TMDSSIIHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTA
DEYLPSVMTCANYLKLPKYTSKDIMRSRLCQAIEEGAGAFLLS
NT seq 4452 nt   +upstreamnt  +downstreamnt
atgtctgaaaataattcgcacaaccttgatgaacatgagtcccatagcgaaaacagtgat
tatatgatggatacgcaggtagaagatgactatgatgaggatggccatgtacagggtgag
tactcttattatcctgatgaagatgaagatgaacatatgctttctagcgtcggaagtttt
gaggcagatgatggtgaagatgacgataacgattaccatcatgaagatgattctggactt
ttatatggatatcatagaactcagaatggcagtgacgaagacagaaatgaagaagaagat
ggacttgaacgttctcacgataataatgaatttggcagcaaccccctacatttacctgac
attttggaaacattcgcacaaagactagaacaaagaagacaaacaagtgaaggacttggg
caacacccggttggaagaacactacccgagattttatcgatgattggaggaaggatggag
aggagcgcagagagttcggcaaggaatgagcggatttctaaattgatagagaatactggg
aatgcctccgaggatccttatattgcaatggagagtttaaaagaactttctgaaaacata
ttaatgatgaatcaaatggttgtcgatagaattataccgatggaaaccttaataggtaat
atagctgccatactctctgataaaattttacgggaagaattagaattacaaatgcaagct
tgtagatgcatgtataatctttttgaggtctgccctgaatctatttcaatagctgttgat
gaacacgttataccaattttacaaggaaaattggtagagatcagttacattgacctcgca
gaacaagttttagaaacggtggaatatatttctagagtacatgggagagacattttaaaa
acgggccaattatcaatctacgtccaattcttcgattttttaactatacatgcgcagagg
aaggctatcgcaattgtttcgaacgcctgtagcagtatccgaacggatgactttaagacc
attgttgaagtacttccaacgctgaagccaattttctcgaatgcgacagaccaaccaata
ttaaccaggcttgtaaatgccatgtacggtatttgcggggcgttgcatggggttgacaaa
tttgagactttgttttcgttggatttaatcgaaagaatagttcagctagtttctattcag
gatacccccttggagaataaactgaaatgtttggatattttaaccgtattagcgatgagt
agtgatgtactttcaagagaactgagagagaaaactgacattgtcgacatggcaacacga
tcattccagcattatagtaaaagtcctaacgcagggttacatgaaacactgatttatgtc
ccaaacagtttattgattagcatttctagatttatagttgtattgtttcctcccgaggat
gaaagaatactgtcagcggataaatataccggaaatagcgaccgtggcgtaatttctaac
caggaaaagtttgattccctagttcaatgtctaattccaattctcgttgaaatttataca
aatgctgctgactttgacgtaagaagatacgtacttattgctttactgagggttgtatca
tgcataaataattccacagcaaaggcaatcaatgatcaacttattaagttaatcggatct
atcctggcccaaaaagaaacagcgtctaacgctaatggtacttactcatcagaagctggt
acactgttggttggtggtctctcgttgcttgacttaatttgtaaaaagttttccgaactg
ttctttccttccatcaaaagagagggcatttttgatttggttaaggatttgtctgtggat
ttcaataacattgatttaaaggaagacgggaatgaaaatatttcactttctgacgaagaa
ggggatttgcatagcagtattgaggaatgtgatgagggtgatgaagaatatgattacgaa
tttactgatatggaaattcctgattcagtaaaaccaaagaaaatttcaatacacattttc
agaactctatctctagcttatattaaaaacaagggtgtgaacctagttaatagagtactt
tctcagatgaacgttgagcaagaagcaataacagaggagctccatcaaatcgaaggcgtt
gtttctattttagaaaatccttccactccggacaaaactgaagaggattggaagggaatt
tggtctgttttaaaaaaatgtattttccatgaagatttcgacgtgtcaggtttcgaattt
acttctacagggctagcttcctccataactaaaagaattacatcctcaacggtatcccat
ttcattcttgctaaatcatttttagaggtatttgaggattgtattgacagatttttagaa
atcctacaatctgctctcacaaggctggagaatttctctatagttgattgcggtttacac
gatggtggtggtgtatcttcactggctaaagagataaaaattaagttggtttatgatggc
gatgcaagcaaagataatattggtactgatttatcatctactatcgtttcggtccattgc
atagcttcttttacctcacttaatgagtttttgagacacagaatggtaagaatgcgtttt
ttgaattcattaatcccaaaccttacatcttccagtaccgaagctgatagggaagaagaa
gaaaattgcttggatcatatgagaaaaaagaactttgactttttttatgataatgaaaaa
gttgacatggagtctacagtatttggtgtgatatttaatacattcgtcaggcgaaatcgt
gacttaaaaactttatgggatgatacacatacaatcaaattttgcaaaagtttagaaggt
aacaatagagagagtgaggcagccgaggaagctaatgaggggaaaaagttaagagatttt
tataaaaaaagagaattcgcacaggttgatactggatcttcagcggatattctgacattg
ctggattttctacatagctgcggtgttaaaagcgacagttttatcaactcaaaactaagc
gctaagctcgctagacaactagatgaaccattggtagtagcaagtggagctttgccggat
tggtcactatttttgaccaggagattcccatttttgtttccgtttgataccaggatgctt
ttcctacaatgtacttcatttggttacggaagattgattcaactttggaagaataagagt
aaaggctcgaaagatttaaggaatgacgaagctttacaacaacttgggagaattactagg
cgtaagctgcggatttcaagaaaaacaatattcgctaccggtctcaagattttatccaag
tacggaagtagccctgacgtactggaaattgaatatcaagaagaagcaggaacaggttta
ggaccgactttggaattttactccgtagtttccaagtattttgcaagaaagtcgttaaat
atgtggcgttgtaactcttatagttacagaagcgaaatggatgttgatactactgacgat
tatattaccactttattgttcccagagcccctcaacccgttttccaataatgaaaaagtt
attgaactttttggatatttggggacatttgttgccagatcgttgcttgataatagaatt
cttgactttagatttagcaaagtcttttttgagttattgcacagaatgtctacgcccaat
gtgacgacagtgccgagcgacgttgaaacctgtctgttaatgatcgaattggtagatccg
ttactcgcaaaatcccttaaatacatagtagcgaataaggatgacaatatgaccctagaa
tcgttgtccttgacatttaccgttcctggaaatgatgacattgagttgattccggggggt
tgtaataaatccttgaactcttctaatgttgaagaatatatccatggcgttatcgaccaa
atattaggtaagggcattgaaaaacagttaaaagcatttattgaaggtttttcaaaggtg
ttttcctatgagaggatgctaatactttttccggatgaattagtggatattttcggacga
gttgaggaagactggtctatggcaactttatacacaaacttgaacgctgaacatggctat
acaatggattcttcaatcattcatgattttatatcaataatatccgcgtttggtaagcat
gaaagaagattatttttgcaatttttaacgggatctcccaagcttccaattgggggattt
aaaagtttgaacccaaagtttacagttgtgttaaagcatgctgaagatggcctaacagca
gacgaatatctaccaagtgtaatgacatgtgctaattatttgaaattgccgaagtatact
agcaaagatattatgcggtctcgtctttgtcaagccattgaagagggtgcaggagctttt
ctactttcctaa

DBGET integrated database retrieval system