KEGG   Saccharomyces cerevisiae (budding yeast): YKL101W
Entry
YKL101W           CDS       T00005                                 
Symbol
HSL1, ELM2, NIK1
Name
(RefSeq) protein kinase HSL1
  KO
K02515  serine/threonine-protein kinase HSL1, negative regulator of Swe1 kinase [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YKL101W (HSL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YKL101W (HSL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YKL101W (HSL1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YKL101W (HSL1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-
     YKL101W (HSL1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   YKL101W (HSL1)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    YKL101W (HSL1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Choline_kinase
Other DBs
NCBI-GeneID: 853760
NCBI-ProteinID: NP_012821
SGD: S000001584
UniProt: P34244
Structure
LinkDB
Position
XI:248920..253476
AA seq 1518 aa
MTGHVSKTSHVPKGRPSSLAKKAAKRAMAKVNSNPKRASGHLERVVQSVNDATKRLSQPD
STVSVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVH
CSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALF
EVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDL
KPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWS
CGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITT
QEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDES
ILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQRHSISLSSSSENKKSATES
SVNEPRIEYASKTANNTGLRSENNDVKTLHSLEIHSEDTSTVNQNNAITGVNTEINAPVL
AQKSQFSINTLSQPESDKAEAEAVTLPPAIPIFNASSSRIFRNSYTSISSRSRRSLRLSN
SRLSLSASTSRETVHDNEMPLPQLPKSPSRYSLSRRAIHASPSTKSIHKSLSRKNIAATV
AARRTLQNSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKKPASENVNKSEPHSLESDS
DFEILCDQILFGNALDRILEEEEDNEKERDTQRQRQNDTKSSADTFTISGVSTNKENEGP
EYPTKIEKNQFNMSYKPSENMSGLSSFPIFEKENTLSSSYLEEQKPKRAALSDITNSFNK
MNKQEGMRIEKKIQREQLQKKNDRPSPLKPIQHQELRVNSLPNDQGKPSLSLDPRRNISQ
PVNSKVESLLQGLKFKKEPASHWTHERGSLFMSEHVEDEKPVKASDVSIESSYVPLTTVA
TSSRDPSVLAESSTIQKPMLSLPSSFLNTSMTFKNLSQILADDGDDKHLSVPQNQSRSVA
MSHPLRKQSAKISLTPRSNLNANLSVKRNQGSPGSYLSNDLDGISDMTFAMEIPTNTFTA
QAIQLMNNDTDNNKINTSPKASSFTKEKVIKSAAYISKEKEPDNSDTNYIPDYTIPNTYD
EKAINIFEDAPSDEGSLNTSSSESDSRASVHRKAVSIDTMATTNVLTPATNVRVSLYWNN
NSSGIPRETTEEILSKLRLSPENPSNTHMQKRFSSTRGSRDSNALGISQSLQSMFKDLEE
DQDGHTSQADILESSMSYSKRRPSEESVNPKQRVTMLFDEEEEESKKVGGGKIKEEHTKL
DNKISEESSQLVLPVVEKKENANNTENNYSKIPKPSTIKVTKDTAMESNTQTHTKKPILK
SVQNVEVEEAPSSDKKNWFVKLFQNFSSHNNATKASKNHVTNISFDDAHMLTLNEFNKNS
IDYQLKNLDHKFGRKVVEYDCKFVKGNFKFKIKITSTPNASTVITVKKRSKHSNTSSNKA
FEKFNDDVERVIRNAGRS
NT seq 4557 nt   +upstreamnt  +downstreamnt
atgactggtcacgtttcaaaaacgagccacgtacccaaaggtcgcccgtcttcattggcc
aagaaggcagctaaaagggccatggccaaagtaaattcgaatccaaaaagggcgtcgggg
catttggagcgtgttgtacaatctgtgaacgacgctaccaaaagattatctcagcccgac
tctaccgtaagtgttgctacaaaatcatcaaagagaaaatccagagacacggtgggtcct
tggaaacttggcaaaacattggggaagggatcttctggtagggttcgcttggctaaaaat
atggaaacaggacaattagctgccattaaaattgtccccaagaagaaagcctttgttcat
tgttctaataatggaactgttcctaattcttactcttcttccatggtcacttccaatgta
tcttctccatcaatagcatctagagaacatagtaaccattctcaaacgaacccatatggc
atagagagagaaatagtaatcatgaaattgatatctcacacaaacgttatggcattgttt
gaagtttgggagaacaaatcagagctgtacctagttttggaatatgttgatggtggcgaa
ttattcgattatctggtctcgaagggaaagctacctgaaagggaggctatccattacttc
aagcagatagttgaaggtgtttcctattgtcattcttttaatatatgccatcgtgatctg
aagcctgaaaatttattattagataaaaagaataggagaatcaaaattgctgatttcggc
atggcagcattagagcttcctaataaacttttaaaaacttcatgtggctctccacactat
gcgtctcctgaaattgttatgggtagaccatatcatggcggtcctagcgatgtctggtcc
tgcggtatcgttttatttgcattactcaccggtcatttaccatttaatgatgacaacatc
aaaaagctgttgttgaaagttcaatcgggcaaatatcaaatgccctcaaatttatcttct
gaggctcgtgatttgatatcaaaaatattggtaattgatccagaaaaaagaattaccact
caagagatattgaagcatcctctgatcaaaaaatatgatgatctcccagttaataaagtg
ctgaggaaaatgagaaaggataacatggcgaggggaaaatctaactcggatttgcatttg
ctaaataatgtctcgccctctattgtaactttacattcaaaaggggaaattgatgaatcc
atcttgaggagtttgcaaattttgtggcatggagtttctcgtgaactaatcactgccaag
ttgcttcaaaagccaatgtcggaggaaaaactattctactcactgttattacaatataaa
caacgtcactcaatatcattgtcctcgtcaagcgaaaacaagaaatcagcaacagaaagt
agcgtaaatgaacctaggattgaatacgcatccaaaactgccaataatacaggcctaagg
agcgagaacaatgatgtgaagactttacattctctagaaattcattcagaagatacttca
acagtgaatcagaacaacgcaattacaggggttaatacagaaattaatgcccctgtattg
gcacaaaaatcgcaatttagtatcaatacgctcagtcaacctgaaagtgataaggctgaa
gcagaagctgtaacattaccacccgctattcccatattcaatgcttcttcatcaaggatt
ttccgtaactcatacacctctatttcatcacgttcgagaagatcgctacgcttatcgaat
tccagattatcattgtccgcttcaacttctagagaaactgtgcatgataatgagatgcct
ctacctcaactgccgaagtcgccttcaagatattcattgtcaagaagggcaatccacgcc
tccccatctactaaatcaatacataaatcactttcgaggaagaatatagctgcaactgtt
gccgctagaagaacactacaaaactcggcttcaaagagatccttatactcattacagtca
atttcaaaacgttccttgaacctgaatgatttattagtctttgacgatcctctccctagt
aagaaaccagcatccgaaaatgtgaataaatcagaaccccattcgttggaatcagactct
gattttgagatcttatgcgatcagatcttatttggaaacgccttagataggatactcgaa
gaggaagaggacaatgaaaaagaacgcgacacccaaagacagaggcaaaacgatacaaaa
tcttcggcagacacttttacgatctctggggtgtctacaaataaggaaaatgagggcccg
gagtatccaaccaaaattgagaaaaatcaattcaatatgtcatataaaccatctgagaat
atgtcagggctctcttcatttcctatctttgaaaaagaaaacacgttaagctcaagttat
ttggaagaacagaagccaaagagagcggccctttcagatatcacgaactcattcaataaa
atgaataaacaggaaggtatgaggatagaaaaaaagattcaaagagaacaacttcaaaaa
aaaaatgaccgcccgtcaccactcaaacctattcagcaccaagaacttcgtgtaaattct
ttgcctaatgatcaaggtaaaccgtccttatctctagatccccgccgtaacatctcccag
ccagtgaattcaaaagtggaatcactattgcagggactgaaattcaaaaaggagccagcc
tctcactggacccatgagagaggttccttgttcatgagtgaacatgtggaagacgaaaaa
ccagtcaaagcctcagatgtttcaatcgaaagttcatatgtacctttaacaacagtagca
acatcttcgagagatcccagtgttttagcagaatctagtacaattcaaaaaccaatgctg
tctttaccttctagttttttgaacacatctatgacgttcaaaaatcttagccagatactc
gctgatgacggtgatgataagcatctaagtgtgccacagaaccaatctagaagtgtagcc
atgtcacaccctttgcgaaaacaatctgccaaaatatctctaactccacggtctaatttg
aacgccaatttatccgttaaacgtaatcagggctcacctggctcctatttgagtaatgat
ctggatggaatctctgatatgacatttgcgatggaaataccaacaaacacctttaccgct
caggcgattcaactgatgaacaacgacacggacaataataaaatcaatacttcgcccaaa
gcatcttcttttacaaaagaaaaagtaatcaaatcggcagcctatatctcgaaggaaaaa
gaaccagataatagcgatactaattatattccagattatactataccaaacacatatgat
gaaaaagccattaatatttttgaagatgcgccctccgatgagggttcattaaatacatct
tcttcagaaagcgattcacgagcaagtgtgcataggaaagcggtatctattgacactatg
gcgacaacaaacgttcttactcccgcgacaaatgttagagtaagtctttattggaataat
aacagttctggtatacccagagagactactgaagagatactttctaaacttagattgtca
ccagaaaatccttctaatacacatatgcaaaagaggttttcttccacgcgtggtagtcgt
gatagtaatgcattaggcatttctcaaagtttacagtcaatgttcaaagatttggaggaa
gatcaagatgggcatacttctcaagctgatattcttgaatcaagtatgagctattcaaag
cgaagaccatctgaggaaagcgttaatccaaaacaacgagtgacaatgcttttcgatgag
gaggaggaagaatctaaaaaagtaggtgggggaaaaattaaagaagagcataccaagcta
gacaataaaatatccgaggaatcttctcaacttgtgttgccggtggttgaaaaaaaggaa
aatgcaaataatacagaaaataactactctaaaataccaaaaccctcaacgattaaagtt
acgaaggataccgctatggaatcaaatacacaaacccatacaaaaaagccaattctaaaa
agtgtccaaaatgttgaagttgaagaagcgccttccagtgataaaaagaattggttcgtc
aaactatttcaaaacttttcttctcataataatgctactaaggcatccaagaatcatgta
acgaatatatcatttgatgatgcgcatatgctaacattaaatgaattcaacaagaatagt
atcgactatcaattaaagaacctagatcacaaatttgggagaaaggtggtggaatacgat
tgtaaatttgtaaaaggcaacttcaaattcaaaatcaagattactagcacacccaatgca
tctacggtaattactgtaaaaaaaagaagcaaacattcaaacacaagttccaataaagcc
tttgaaaagtttaatgatgatgtggagagagtaattcgaaatgccggacgttcataa

DBGET integrated database retrieval system