KEGG   Saccharomyces cerevisiae (budding yeast): YLL023C
Entry
YLL023C           CDS       T00005                                 
Symbol
POM33
Name
(RefSeq) nucleoporin POM33
  KO
K20724  transmembrane protein 33
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YLL023C (POM33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLL023C (POM33)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLL023C (POM33)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    YLL023C (POM33)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    YLL023C (POM33)
SSDB
Motif
Pfam: TMEM33_Pom33 Hum_adeno_E3A
Other DBs
NCBI-GeneID: 850637
NCBI-ProteinID: NP_013077
SGD: S000003946
UniProt: Q12164
LinkDB
Position
XII:complement(97997..98836)
AA seq 279 aa
MSSRPANNQGPPNLPARDKSLVQRFMAVAKSLQFAWFTGHSVVLISSILYLLKMSEFYYR
SAYLGVIESFGIIIYQQFFTRNEPLQTQDAAATKASIKSRVAGLLKSEDVLYLVLANFWL
FTPRFSFSLIPFFAFAVFHVLIYVEKVLLPKVFHLSSKDSSKILSFIDKFVVQYNDLCMH
WVGTAELLIFILVLFRAILCFQRSWIILVVYAIFIKLRYENSKYMKAAFAQWRVRMDGII
SHPSIPPFVKRAYNAIKMSLIRLSEYRLSGAPQVTKKQN
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcatcaagacccgctaataaccaaggccccccaaacctccctgccagagataagtcg
ctcgtgcaaaggttcatggcagtagccaagagcttgcagtttgcatggtttaccggtcat
tccgtcgtattgatcagctccattctttacctgctcaagatgtcagaattttattacaga
tcggcatatctcggtgtcatcgaatctttcggtatcatcatttaccagcaatttttcacc
cgcaatgaaccattgcagactcaagatgccgctgccactaaggcttccataaaatcacgc
gttgctggactcctaaagagtgaagacgtgctttatttggttttggccaacttctggttg
ttcactccaagattttcattcagcttaatcccatttttcgcgtttgctgtattccatgtt
ttaatctacgttgaaaaagttctcttaccaaaagtcttccacctttccagtaaagattca
agtaagatcctcagcttcatcgacaagtttgttgttcagtacaatgacttgtgcatgcac
tgggtcggtactgctgagctgcttattttcattttggtccttttcagagccattctgtgc
ttccaaaggtcttggatcatacttgttgtgtacgccatctttattaagttaagatacgaa
aactccaagtacatgaaagccgcctttgctcaatggagagttagaatggacgggatcata
agccacccatctatcccaccattcgtcaaaagagcttataatgcaattaaaatgagcttg
atccgcttgtctgagtaccgcttaagcggtgccccacaagtgaccaagaagcagaattga

KEGG   Saccharomyces cerevisiae (budding yeast): YLR064W
Entry
YLR064W           CDS       T00005                                 
Symbol
PER33
Name
(RefSeq) Per33p
  KO
K20724  transmembrane protein 33
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YLR064W (PER33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLR064W (PER33)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR064W (PER33)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    YLR064W (PER33)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    YLR064W (PER33)
SSDB
Motif
Pfam: TMEM33_Pom33 LapA_dom
Other DBs
NCBI-GeneID: 850753
NCBI-ProteinID: NP_013165
SGD: S000004054
UniProt: Q12144
LinkDB
Position
XII:265456..266277
AA seq 273 aa
MTVPRNRPMAPFGTIIKSRIKQPQFYWFIGHFLTIFNFIQFHLSITSKQNQLSCYRRSLF
YISVTYAIVLYQFFKSDQLKFNFTLLRQEMKKLDNLQYFAMLFILFLLSQFNIIISGSLY
SPVIFSIFHFLNYFKENLLPFLPLIPLNLKNLLNSKITVFIQNYNGFFLQMAQVFEIICG
LRVGLFLVPFNFFLLLVRRANVSFEVVGTMLAGLTYVWFFKLRYLQSESMRQIFKQYVLR
LDAYVSRTLPPYCSRLWNGYKNFVMTVFWKIPV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaccgttcccaggaatcgtcccatggcaccatttggcaccattatcaaatcaagaata
aaacaaccccagttttattggtttataggccattttttaaccatctttaactttatacaa
tttcatctttcaatcacgtccaaacaaaaccaattgtcatgctatagaagatcattattt
tacatatccgttacatatgccatcgttctttaccagtttttcaaaagtgaccagttaaag
ttcaattttacgcttttgcgccaagagatgaagaaattggataatttgcagtattttgcc
atgctattcatactttttctcttatcacagtttaacatcataatcagcggctcgttatac
agtcccgttatcttttcaatctttcacttcctgaactattttaaggaaaaccttttgcca
tttttgcctttgataccacttaatttgaaaaatttgttgaactccaaaataacggtattc
atccaaaactacaatggatttttcttacagatggcgcaagtatttgagattatctgcggc
ctacgtgtgggcctcttcttagtgcccttcaattttttcttgttgttggtaagaagagca
aacgtgtcgtttgaggtagtgggtacaatgttggcaggactaacctatgtatggtttttc
aaattaaggtacctacaaagtgaatctatgaggcagatatttaaacaatatgtccttagg
ttggatgcatatgtcagccgtactttgcccccatattgttcccgtttatggaacggctat
aagaatttcgttatgacagtgttttggaagatacctgtgtag

DBGET integrated database retrieval system