KEGG   Saccharomyces cerevisiae (budding yeast): YLR176C
Entry
YLR176C           CDS       T00005                                 
Symbol
RFX1, CRT1
Name
(RefSeq) Rfx1p
  KO
K09175  regulatory factor X, other
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR176C (RFX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YLR176C (RFX1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Other basic domains
   RF-X
    YLR176C (RFX1)
SSDB
Motif
Pfam: RFX_DNA_binding Pox_D5 Cdc6_C
Other DBs
NCBI-GeneID: 850873
NCBI-ProteinID: NP_013277
SGD: S000004166
UniProt: P48743
LinkDB
Position
XII:complement(507797..510232)
AA seq 811 aa
MVIFKERKPTENLFTRKIPAKYFIFSPSFLSVHYFEFYLPMSGDNNIEPTSRGSNDNSNG
PSNGSSVNSNRYSLNAPKYSSQPPPASHTYLPPMSVNIPPIASKSSSIYSLLHQSSPRPE
TPNPILPPLIGSGPGSHKPSPTPTQPPAQPATQRQPATYSVYPASISLNRSNSSAYPLSF
KSEETLNNNPPTAAKRTNTFPSIPSSTKKQKTSQEKRISSISRRNTQEIIAKQIAENNKS
KTIEEYAQIVKHAEIKVLSMDSQNTSKAALQLAEQNRERERQVFALLWLMKNCKSQHDSY
VPRGKIFAQYASSCSQNNLKPLSQASLGKLIRTVFPDLTTRRLGMRGQSKYHYCGLKLTV
NESGSVSLNNNNASLSLVHNNDPISPLSSPSPSSPSPQVPNVSSPFSLNRKSLSRTGSPV
KQSSNDNPNEPELESQHPNETEANKLDSLPPAANNPTGTLSSDELTFTHDLIEKVFNCND
KLSDNYNTQILSNTEHPLLTSYKLDFPKIPAGVLPTDTDSDVISSLESLYHIHCNSVYEC
IKFLKSDNISNALFFSNSNSISPTMFNLFISEPLIDWVTKCDLITYTGLIKFFSQFIIHS
NEISDSIIQKLESMIKLLPEQINKAVLELPKALVQRKLSIINNFTKLVKKLIKLLKFILN
FLKSFPIFKSGMNNDWKNIVNLDDILEMMINEDDTNSETNTIMQHLQGFCQVFVTKFLNS
SMSVSNDPSVSIECKSLNEMIKDFCSFISLQSKFSCLKLIDCSTRFRNAIIGDISLKSNE
NLLSWLFLNNVMGQLLNYCFEVMKFVNGLKV
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggtaatcttcaaagaacgcaaaccaacagaaaaccttttcactagaaaaatacctgcc
aagtacttcatcttctcgcctagttttttgtctgttcattattttgaattttatttgccc
atgtccggtgataataacattgaacctactagtcggggctcgaacgacaatagcaacggt
ccaagtaacggatcttcggtaaacagtaatcggtacagtttaaacgcacccaagtacagc
agccaaccaccgccagcatcacacacttatttgccccccatgtcagtgaatatcccgccc
atagcgagcaaatcatcgtcaatatacagcctgctacaccaaagttccccccgcccggag
acgccaaatccaatattaccgccacttatcggtagtggtcccggctcccataaaccatct
cctacccctacacagcctcctgcacaacccgcaacacaacggcaacctgccacatactca
gtgtatccagcgtctatcagcctgaatagatcgaattcatctgcttacccactttctttc
aagtcagaggaaaccttaaacaataatcctcctactgctgccaaacgtaccaataccttc
ccctcaattccaagcagtacgaaaaaacagaaaacaagccaagagaaacgaatctcttcc
atttcaaggagaaacacgcaagaaataattgctaagcaaattgcagaaaataacaaatct
aaaaccatcgaggagtatgcgcagatcgtgaagcatgcagaaatcaaagtcctgagcatg
gactcacagaacacttcaaaggcagctttgcagctggcggaacaaaacagagaaagagaa
agacaagtgtttgcgttactttggttaatgaaaaattgtaaatctcagcacgatagttac
gtaccaagaggcaaaatatttgctcaatacgcttcatcttgttcccaaaacaacctgaag
cccttatcacaggcgtcattagggaagttgataagaacagtttttcctgatttaacgact
agaaggctgggtatgagaggtcaatccaaataccactactgcggattgaaactaactgtc
aacgaaagcggctccgtgtcccttaataacaacaatgcttcgttatccttagtacacaat
aacgatcccatatcgcccctatcgtctccatcgccctcttcaccttcgccgcaggtacct
aacgtttcatcgccgttctcattaaatagaaaaagtctttctcgaactgggtcgcccgtt
aaacagagtagtaatgacaaccctaacgaaccagaactcgaatcacagcatccaaacgaa
acagaagcaaataaactagattcgctgccaccagcggcaaataaccctaccggaacactg
tcttcagatgaattaactttcactcatgatttaattgaaaaagttttcaattgtaatgac
aagctatcagataactataatacccaaatattatcgaacacagaacatccgcttttgaca
tcatataagttagacttcccaaaaattcccgcaggtgtactccccacagacactgattcg
gatgttatatcatccttggagtcattatatcatatccattgcaactccgtttatgaatgc
atcaagtttctgaagagtgataatatatcaaatgcattattcttctctaactctaactct
atatcgcccacgatgtttaatctattcatttctgagccattgattgattgggtaactaaa
tgtgacttaatcacctatacagggttaatcaaatttttttcacaatttataattcattct
aatgagatcagtgactcaatcattcaaaaactggaaagtatgatcaagctattgcccgaa
caaattaataaggctgttttagaattaccaaaagcgctagtgcaaaggaagttatcaatt
attaataattttaccaaactagtgaaaaaactaataaagttattaaaattcattctaaac
ttcttgaaaagttttcctatatttaaaagtggcatgaataatgactggaagaatattgta
aatttagacgatattttggaaatgatgattaatgaagacgatacaaattcagagacaaac
acaataatgcaacatttacaagggttctgtcaagttttcgtaacaaagttcttaaattcc
tctatgagcgttagcaatgatccctctgtgtctatcgaatgcaagtccttaaatgaaatg
attaaagatttttgttcctttatttccctacaaagcaaattttcgtgcttgaaattaatt
gattgcagcacaagattcaggaatgcaataatcggcgatattagcttaaaatcaaatgag
aatttgctatcatggttgtttctaaataatgtcatgggccaattgctgaactactgtttt
gaagtcatgaaattcgtcaatggcctaaaagtttaa

DBGET integrated database retrieval system