KEGG   Saccharomyces cerevisiae (budding yeast): YLR234W
Entry
YLR234W           CDS       T00005                                 
Symbol
TOP3, EDR1
Name
(RefSeq) DNA topoisomerase 3
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YLR234W (TOP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YLR234W (TOP3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YLR234W (TOP3)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     YLR234W (TOP3)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Topoisomerases
   YLR234W (TOP3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     YLR234W (TOP3)
   FA (Fanconi anemia) pathway
     YLR234W (TOP3)
SSDB
Motif
Pfam: Topoisom_bac Toprim
Other DBs
NCBI-GeneID: 850935
NCBI-ProteinID: NP_013335
SGD: S000004224
UniProt: P13099
LinkDB
Position
XII:609783..611753
AA seq 656 aa
MKVLCVAEKNSIAKAVSQILGGGRSTSRDSGYMYVKNYDFMFSGFPFARNGANCEVTMTS
VAGHLTGIDFSHDSHGWGKCAIQELFDAPLNEIMNNNQKKIASNIKREARNADYLMIWTD
CDREGEYIGWEIWQEAKRGNRLIQNDQVYRAVFSHLERQHILNAARNPSRLDMKSVHAVG
TRIEIDLRAGVTFTRLLTETLRNKLRNQATMTKDGAKHRGGNKNDSQVVSYGTCQFPTLG
FVVDRFERIRNFVPEEFWYIQLVVENKDNGGTTTFQWDRGHLFDRLSVLTFYETCIETAG
NVAQVVDLKSKPTTKYRPLPLTTVELQKNCARYLRLNAKQSLDAAEKLYQKGFISYPRTE
TDTFPHAMDLKSLVEKQAQLDQLAAGGRTAWASYAASLLQPENTSNNNKFKFPRSGSHDD
KAHPPIHPIVSLGPEANVSPVERRVYEYVARHFLACCSEDAKGQSMTLVLDWAVERFSAS
GLVVLERNFLDVYPWARWETTKQLPRLEMNALVDIAKAEMKAGTTAPPKPMTESELILLM
DTNGIGTDATIAEHIDKIQVRNYVRSEKVGKETYLQPTTLGVSLVHGFEAIGLEDSFAKP
FQRREMEQDLKKICEGHASKTDVVKDIVEKYRKYWHKTNACKNTLLQVYDRVKASM
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgaaagtgctatgtgtcgcagagaaaaattctatagcgaaggcagtttcacagatccta
ggaggaggcagatcaacttcaagggattccggctacatgtatgtaaagaactatgatttc
atgtttagtgggttcccgtttgccagaaatggggctaactgcgaagttaccatgactagt
gttgcagggcacctaacaggcattgatttcagccatgattcgcatgggtggggaaaatgc
gccatccaagagttatttgatgcgccactgaacgagattatgaataacaaccaaaaaaag
atagcaagcaacatcaagcgagaagcgaggaatgcagactatctgatgatatggacagat
tgcgaccgggaaggagagtacatcggttgggagatatggcaggaggccaagagaggcaac
aggctcatacaaaatgatcaagtataccgggcagtcttttcgcatctcgaaagacaacac
atattaaatgcagcacgaaacccaagtcgattggatatgaagagtgtgcacgctgtaggc
acgcggattgaaatcgatcttcgagcaggtgttacattcaccagactcttaacagaaacg
ctacgaaataaactgagaaaccaagccaccatgaccaaggatggtgcaaaacaccgcggt
ggtaacaagaacgactcacaagtcgtatcgtatggtacatgccagtttccaacgctcggc
tttgtagtagacaggtttgaaagaatacgaaattttgttcccgaagagttctggtatatc
caattggtagtcgaaaacaaagacaacggcggaacaacaacgttccagtgggacaggggc
cacttgttcgaccggctgagcgtgttaacgttttacgagacatgcatcgaaaccgccggc
aatgttgctcaagtagtagacttgaaatcaaagccaacaacgaaatacagacctttacct
ctgaccacagtggagctacaaaaaaactgcgcccggtacctgcgtctgaacgccaaacaa
tcactagacgcagcagaaaagctataccaaaaggggttcatatcgtatccaagaacagag
actgatactttcccacacgcaatggacctaaaatccttggtcgaaaagcaagctcaattg
gaccaactcgctgcaggcggcagaaccgcctgggcatcgtacgcggcatcgctgctccaa
cccgaaaacacaagtaacaataacaagttcaagtttccacgaagcggctcccatgacgac
aaagcgcatccaccaatccaccccatcgtaagtctggggcctgaagcaaatgtttcgcca
gtggaaagaagagtatacgagtacgtggccaggcactttttggcatgctgctcagaggac
gccaagggccaatcgatgacccttgtgttggactgggccgttgaacgtttctcagcttca
ggtctcgtagtcctagagagaaatttcctcgatgtttacccttgggcccgatgggaaacc
accaagcagttaccgcggcttgaaatgaatgccctcgtagacatcgcgaaggccgaaatg
aaggcgggcactacggcgccgcccaagccgatgactgagagtgaactcattctcctcatg
gatacaaacggcattggcacagacgccaccattgcggagcacatagacaagatccaagta
cgtaattacgttaggagcgagaaagtaggcaaggaaacctacttacaacccacgaccctg
ggtgtctcactagtgcacggcttcgaggccatcggcctcgaagactcctttgcaaagccc
ttccagcgcagagaaatggagcaagacctcaagaaaatctgcgaaggtcatgcctccaag
actgatgttgtaaaggacatagtcgagaagtataggaagtactggcacaagacgaatgcc
tgcaagaatactctcttgcaagtttatgaccgtgtcaaggcatccatgtaa

DBGET integrated database retrieval system