KEGG   Saccharomyces cerevisiae (budding yeast): YLR306W
Entry
YLR306W           CDS       T00005                                 
Symbol
UBC12
Name
(RefSeq) NEDD8-conjugating protein UBC12
  KO
K10579  ubiquitin-conjugating enzyme E2 M [EC:2.3.2.34]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YLR306W (UBC12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YLR306W (UBC12)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     YLR306W (UBC12)
Ubiquitin system [BR:sce04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   YLR306W (UBC12)
SSDB
Motif
Pfam: UQ_con DUF6582
Other DBs
NCBI-GeneID: 851015
NCBI-ProteinID: NP_013409
SGD: S000004297
UniProt: P52491
Structure
LinkDB
Position
XII:join(744151..744153,744288..744851)
AA seq 188 aa
MLKLRQLQKKKQKENENSSSIQPNLSAARIRLKRDLDSLDLPPTVTLNVITSPDSADRSQ
SPKLEVIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILR
EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVRLTMSGGSIEHV
KYDNIVSP
NT seq 567 nt   +upstreamnt  +downstreamnt
atgttgaaattacgccaattacaaaagaaaaagcaaaaagaaaatgaaaacagcagttct
attcagcctaatttatcggcagcaagaattcgtttgaaaagggaccttgattcgctggac
ctcccaccaacagtgactttgaatgtaataacatcaccagatagtgcggatagatcacaa
tcgccgaaattggaggtaattgttaggcctgatgaaggatattataattatggatctatt
aatttcaatttggattttaacgaagtttatccgattgaaccaccaaaagttgtatgtttg
aagaagatctttcatccaaatatcgatttaaaggggaacgtttgcctaaatattcttcga
gaagactggtcgccagctctagatttgcagagtattataaccgggcttcttttcttgttc
ttggagcctaatcccaatgacccgttaaacaaggatgcagcaaagttactgtgtgagggt
gagaaagaatttgctgaagctgtgagattgaccatgtctggaggttcaattgaacatgtc
aaatatgataacatagtttctccttga

DBGET integrated database retrieval system