KEGG   Saccharomyces cerevisiae (budding yeast): YMR055C
Entry
YMR055C           CDS       T00005                                 
Symbol
BUB2, PAC7
Name
(RefSeq) Bub2p
  KO
K02179  cell cycle arrest protein BUB2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YMR055C (BUB2)
SSDB
Motif
Pfam: RabGAP-TBC
Other DBs
NCBI-GeneID: 855077
NCBI-ProteinID: NP_013771
SGD: S000004659
UniProt: P26448
LinkDB
Position
XIII:complement(386101..387021)
AA seq 306 aa
MTSIEDLISNPPLLLHSSLSQLRYLILSEGLPISEDKQQQRTRCYVWTVLSQTSMEASTQ
RYLALLKLGPPSTTIYQKIKNDTSRTFQTDPNFRNRVSEDALIRCLSCFAWQTQQRRQKT
RFGRIPVSTYVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMIPTYLTKNLNGAQNGAKL
LDISLRIIDPKLSKFLSDNLLTAEIYGMPSILTLSSCNKPLDQVIKLWDFMFAYGFHMNI
LFVVAFLVKMRSKVFKSDSPVNLLRQFPDFDADEIIRLGVGFIAKIPAQIYDLLVDHLTD
PDIYIP
NT seq 921 nt   +upstreamnt  +downstreamnt
atgacctcaattgaagatctgatatcaaatcctcccctgctactgcattcctcactctct
caacttcgctacctcatactcagtgaagggcttcccatatctgaagataaacagcagcag
cgcacgcgatgttacgtgtggacggtgctctctcaaacttctatggaggcgtctacacaa
cggtaccttgcgctcttgaaactgggcccaccttccacaaccatttaccaaaaaatcaag
aacgacacatccagaacttttcagacggatccaaactttagaaatagagtctcagaggat
gccctcatccggtgtctgtcgtgctttgcttggcaaacacaacaaagaagacaaaagact
cgttttggtcgcattcctgtgagcacatatgtgcagggcatgaacgtgttattagctcct
ctgctttactcatgtccttctgaacctatggcgtatcaacttttcactaagctttgttat
gaaatgataccgacgtatctaactaagaacctaaacggcgcccagaacggcgccaaacta
ctagatatttctctcagaatcattgatccaaagctgagtaaatttctatcggacaattta
cttacagcagagatttatggtatgccttccatactcacgttatccagctgcaataaaccg
cttgatcaggtcattaaactgtgggatttcatgtttgcatatggattccatatgaatatt
ctctttgtggtggcattcctagttaaaatgagatccaaggttttcaaatcggattcccct
gttaatttactacgacagtttccggattttgatgctgacgagatcattcggctgggcgtc
gggttcatcgctaagatccctgctcaaatttatgacctattggtagaccacttgaccgac
ccagacatatatataccgtaa

DBGET integrated database retrieval system