KEGG   Saccharomyces cerevisiae (budding yeast): YMR190C
Entry
YMR190C           CDS       T00005                                 
Symbol
SGS1
Name
(RefSeq) ATP-dependent DNA helicase SGS1
  KO
K10901  bloom syndrome protein [EC:5.6.2.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YMR190C (SGS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YMR190C (SGS1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YMR190C (SGS1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     YMR190C (SGS1)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    YMR190C (SGS1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     YMR190C (SGS1)
    Bloom's syndrome complex (BTR)
     YMR190C (SGS1)
   FA (Fanconi anemia) pathway
     YMR190C (SGS1)
SSDB
Motif
Pfam: Helicase_Sgs1 RQC Helicase_C DEAD RecQ_Zn_bind ResIII HRDC
Other DBs
NCBI-GeneID: 855228
NCBI-ProteinID: NP_013915
SGD: S000004802
UniProt: P35187
Structure
LinkDB
Position
XIII:complement(640915..645258)
AA seq 1447 aa
MVTKPSHNLRREHKWLKETATLQEDKDFVFQAIQKHIANKRPKTNSPPTTPSKDECGPGT
TNFITSIPASGPTNTATKQHEVMQTLSNDTEWLSYTATSNQYADVPMVDIPASTSVVSNP
RTPNGSKTHNFNTFRPHMASSLVENDSSRNLGSRNNNKSVIDNSSIGKQLENDIKLEVIR
LQGSLIMALKEQSKLLLQKCSIIESTSLSEDAKRLQLSRDIRPQLSNMSIRIDSLEKEII
KAKKDGMSKDQSKGRSQVSSQDDNIISSILPSPLEYNTSSRNSNLTSTTATTVTKALAIT
GAKQNITNNTGKNSNNDSNNDDLIQVLDDEDDIDCDPPVILKEGAPHSPAFPHLHMTSEE
QDELTRRRNMRSREPVNYRIPDRDDPFDYVMGKSLRDDYPDVEREEDELTMEAEDDAHSS
YMTTRDEEKEENELLNQSDFDFVVNDDLDPTQDTDYHDNMDVSANIQESSQEGDTRSTIT
LSQNKNVQVILSSPTAQSVPSNGQNQIGVEHIDLLEDDLEKDAILDDSMSFSFGRQHMPM
SHSDLELIDSEKENEDFEEDNNNNGIEYLSDSDLERFDEERENRTQVADIQELDNDLKII
TERKLTGDNEHPPPSWSPKIKREKSSVSQKDEEDDFDDDFSLSDIVSKSNLSSKTNGPTY
PWSDEVLYRLHEVFKLPGFRPNQLEAVNATLQGKDVFVLMPTGGGKSLCYQLPAVVKSGK
THGTTIVISPLISLMQDQVEHLLNKNIKASMFSSRGTAEQRRQTFNLFINGLLDLVYISP
EMISASEQCKRAISRLYADGKLARIVVDEAHCVSNWGHDFRPDYKELKFFKREYPDIPMI
ALTATASEQVRMDIIHNLELKEPVFLKQSFNRTNLYYEVNKKTKNTIFEICDAVKSRFKN
QTGIIYCHSKKSCEQTSAQMQRNGIKCAYYHAGMEPDERLSVQKAWQADEIQVICATVAF
GMGIDKPDVRFVYHFTVPRTLEGYYQETGRAGRDGNYSYCITYFSFRDIRTMQTMIQKDK
NLDRENKEKHLNKLQQVMAYCDNVTDCRRKLVLSYFNEDFDSKLCHKNCDNCRNSANVIN
EERDVTEPAKKIVKLVESIQNERVTIIYCQDVFKGSRSSKIVQANHDTLEEHGIGKSMQK
SEIERIFFHLITIRVLQEYSIMNNSGFASSYVKVGPNAKKLLTGKMEIKMQFTISAPNSR
PSTSSSFQANEDNIPVIAQKSTTIGGNVAANPPRFISAKEHLRSYTYGGSTMGSSHPITL
KNTSDLRSTQELNNLRMTYERLRELSLNLGNRMVPPVGNFMPDSILKKMAAILPMNDSAF
ATLGTVEDKYRRRFKYFKATIADLSKKRSSEDHEKYDTILNDEFVNRAAASSNGIAQSTG
TKSKFFGANLNEAKENEQIINQIRQSQLPKNTTSSKSGTRSISKSSKKSANGRRGFRNYR
GHYRGRK
NT seq 4344 nt   +upstreamnt  +downstreamnt
atggtgacgaagccgtcacataacttaagaagggagcacaaatggttaaaggaaacggcg
actttacaggaagacaaagatttcgtattccaggctatccaaaagcacatcgcgaacaaa
aggcctaagacaaattcgccaccaacaacgccatccaaagatgaatgtggaccaggaaca
acaaactttataaccagcattcctgcatctggaccaacgaatactgctacgaaacaacat
gaagtcatgcaaactttgtcgaacgatacagaatggctctcgtacactgccacatcgaat
caatatgctgacgtacccatggttgatataccagccagcacaagtgttgtatcgaacccg
aggacgcccaatggctcgaaaactcacaatttcaatacttttcgaccgcacatggctagt
tctcttgtcgaaaatgacagtagcagaaatctaggtagtagaaataacaataaaagcgta
atcgataattcaagtataggcaaacagctcgaaaatgatataaaattagaggtgatccgc
cttcaaggctccctaattatggcattgaaagagcaatcgaaattattgctacagaagtgt
agtattatcgaatccacatcattgtcagaggacgctaaaaggctacagttaagtagggat
atacggcctcagttatcaaatatgtcgatacgaatagatagtctggaaaaggagatcata
aaagccaaaaaagatggaatgtcaaaagatcaaagtaaaggtcgcagtcaagtttcttca
caagatgataatatcatatcaagcattctgcccagccccttggaatacaatacatcttcc
aggaattcaaacctgacaagtactactgcgactaccgtcactaaggcattagccatcact
ggtgcgaagcaaaatattactaataacaccggtaagaatagcaataatgatagtaataac
gatgatttgattcaagtcctggatgatgaggatgatatagactgtgaccctcctgtaata
ttgaaggagggggctccacattctcccgcattcccgcatctccacatgacgtcagaagaa
caagatgaacttacaagaaggagaaatatgcgttcaagagaaccagtcaactacagaata
cctgatagggatgatccttttgactatgttatgggtaaatctttgagggacgattatccg
gatgtcgaaagagaagaagatgagttaacaatggaggcagaagatgatgcccattccagc
tacatgactactagagatgaagaaaaagaagaaaacgaattactaaatcaaagcgatttt
gattttgtggtaaacgacgacctagacccaactcaagacacagattatcatgataatatg
gatgttagtgcaaatattcaggaaagttctcaagaaggtgacactaggtccacaattacc
ttgtcgcaaaataaaaatgttcaagttattttatcatctcccacagcacagagcgttccc
tcaaatggccaaaatcaaataggcgtggagcatattgacttgttggaagatgatctggaa
aaggacgcaattttggatgatagcatgagtttctcctttggccgtcaacacatgcccatg
tctcattctgatctagagttgatagacagcgaaaaagaaaatgaggattttgaagaagat
aataacaataacggtatcgagtacctatcagatagcgatttagaaagatttgacgaagaa
agagagaatagaacccaagtagcagatatccaggaactagacaatgacctgaaaataata
acagaaaggaagcttacaggtgacaatgaacacccaccaccatcttggtctcccaaaata
aaaagggagaaatccagtgttagtcaaaaggatgaggaagacgattttgatgacgatttt
tcattaagtgatatagtgagtaaatccaatttatcttctaagacgaatggtccaacctat
ccttggtctgatgaagttttatatcgtttacatgaagtctttaaactgcctggttttaga
cctaaccaactagaggctgtaaatgcaactttgcaaggtaaggatgtttttgttcttatg
ccaacagggggtggtaaatctctttgctatcaacttcctgcagtggtgaaatcgggtaaa
acacatggtactactattgtcatctctccgctaatttccctgatgcaagatcaagtggaa
catttattgaataaaaatattaaggcgagcatgttcagttcgaggggtactgccgagcaa
agacgacaaactttcaatttatttattaatggattattggatttagtttacatatctcct
gagatgatcagtgcctcagaacaatgcaagagagctatcagtagattatacgcagacggt
aagttggctcgtattgttgtagatgaagcacattgtgtttctaactggggccacgatttc
aggcctgattataaagaattaaaatttttcaaaagagaataccctgatattccaatgatt
gctttaactgcaactgcaagtgaacaagtcagaatggacatcattcacaatttagaacta
aaggaacctgttttcctaaaacaaagttttaatagaacaaatttgtattacgaagtaaac
aagaagaccaaaaataccatttttgaaatctgtgatgcggttaaatctaggttcaaaaat
caaacgggtataatatattgccactccaagaaatcatgcgagcaaacatcagcccaaatg
caaagaaatggcatcaagtgtgcatattaccatgcaggcatggagcctgatgaaagatta
agtgtacagaaggcatggcaggcggatgagatacaagtcatttgtgctactgttgctttc
ggaatgggtattgataaacctgatgtgagatttgtttaccactttaccgttccccgaaca
ttagaaggctattatcaagaaaccggccgtgctggaagagatgggaactattcatattgt
attacctacttttcattcagggacattagaaccatgcagacaatgatccagaaggataag
aacttagacagagagaataaggaaaaacatctgaataaattacagcaagtaatggcatac
tgtgacaacgttactgactgcagaagaaagttagttttatcttatttcaatgaggatttt
gactccaaactgtgtcataaaaactgtgataattgtagaaatagcgccaacgtgataaac
gaggaaagggatgttacagaacctgccaagaagattgtaaaattagtggaaagtatccaa
aatgaaagagtcacaataatttattgccaagatgtctttaaaggttcgagaagctccaaa
attgttcaggctaaccatgacaccttagaggagcatggtattggtaaatccatgcaaaaa
tcagaaatcgaaaggattttcttccatttgattacgatccgagttttacaagagtattca
ataatgaacaatagcggttttgcttcaagctatgtgaaagttggtcccaatgctaagaaa
ttgctgactggaaaaatggagataaagatgcaatttacaatatcagcaccaaactcccgt
ccctcgacatcttctagctttcaagcaaatgaagataatataccagttatcgcgcagaaa
tcaacaaccattggaggaaatgtggctgctaatccaccgcgctttataagtgcgaaggaa
cacctaagatcgtatacatacggcggttcgaccatgggtagctcacatccgatcactttg
aaaaacacaagcgatttacgctcgacacaagaacttaataatctgcgaatgacatacgaa
cgtctgagggaattatctttaaatttaggaaatagaatggttcctccagttgggaacttt
atgcctgacagtattttaaaaaagatggcagcaatattaccaatgaatgattcggctttt
gcaactttaggcacagtggaggacaaatatcgccgaaggttcaagtactttaaagccacg
atagcagatcttagcaaaaagagatcaagcgaggatcatgaaaaatacgacacaatacta
aatgatgaatttgtgaacagggccgcggcttccagcaatgggattgcccaaagtactgga
acaaaatctaagttttttggcgccaatttaaacgaagccaaagaaaatgaacaaattatc
aatcaaatcagacaaagccaattacccaaaaataccacaagcagcaaatcaggtacaagg
tccatcagtaagtcgtccaagaagtctgctaatgggagacgaggttttagaaattaccga
ggtcactacagaggaagaaagtga

DBGET integrated database retrieval system