KEGG   Saccharomyces cerevisiae (budding yeast): YOL001W
Entry
YOL001W           CDS       T00005                                 
Symbol
PHO80, AGS3, TUP7, VAC5
Name
(RefSeq) Pho80p
  KO
K06654  phosphate system cyclin PHO80
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YOL001W (PHO80)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YOL001W (PHO80)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Fungal regulators
    YOL001W (PHO80)
SSDB
Motif
Pfam: Cyclin
Other DBs
NCBI-GeneID: 854161
NCBI-ProteinID: NP_014642
SGD: S000005361
UniProt: P20052
Structure
LinkDB
Position
XV:325249..326130
AA seq 293 aa
MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD
QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH
RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC
SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK
VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaaagcacatcaggagaacgttccgaaaatatacatgaggatcaagggataccaaaa
gtaattctgcccgctgattttaataaatgctctagaactgacctagtggtgctcatatca
cgaatgttagtatcgctgatagcaatcaatgaaaattcagcaacaaagaaatctgatgac
caaattactttaacacgataccattctaagattcctccaaacatatcaatcttcaactat
ttcatacgactgacaaagttttcctctttagaacattgtgtgcttatgacatcactctat
tatatcgatttattgcaaactgtgtatcctgattttacgcttaattcgttgactgcccat
aggtttttattaacagccaccacagtcgcaacaaaaggcttatgtgattcgttctcaaca
aacgcccattatgcaaaagttggaggagtacgatgtcacgaattgaatatactggagaac
gattttttaaagagagtaaactacagaatcattccgcgggatcataacattacgttatgt
agtatagagcaaaaacagaaaaagtttgtcatagataaaaacgcattagggtctctcgat
ttggattcttattcttacgttaatcgtccaaaaagtggatataatgttctagataaatac
tatcgaagaatagttcagctggtgggttcctttaacgcttcacctgataagagtagaaag
gttgattatgttctcccgccaaatattgatatagtgagtgaaagtggctcccaaactact
caactaaaggggtcgtcatcacccaattctcactcttcacaaaagcgatattctgaggca
aaggacgcacatatctataacaagcgatcaaagccagattaa

DBGET integrated database retrieval system