KEGG   Saccharomyces cerevisiae (budding yeast): YPR025C
Entry
YPR025C           CDS       T00005                                 
Symbol
CCL1
Name
(RefSeq) TFIIH complex kinase subunit CCL1
  KO
K06634  cyclin H
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YPR025C (CCL1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YPR025C (CCL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YPR025C (CCL1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YPR025C (CCL1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YPR025C (CCL1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YPR025C (CCL1)
SSDB
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB MRP-L28
Other DBs
NCBI-GeneID: 856136
NCBI-ProteinID: NP_015350
SGD: S000006229
UniProt: P37366
Structure
LinkDB
Position
XVI:complement(613377..614558)
AA seq 393 aa
MTDIQLNGKSTLDTPSATMSAKEKEAKLKSADENNKPPNYKRISDDDLYRHSSQYRMWSY
TKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKVLEAKAIPLTMEEELDLVNFY
AKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISV
DSFAQKAKSTRDSVLKFEFKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQ
IYDRCKKRITAALLTDVVYFYTPPQITLATLLIEDEALVTRYLETKFPSREGSQESVPGN
EKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKPPSTEEAKKIAAK
NYYCQNPSTLIQKLKRKLNGEDTSSTVEKKQKT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgacggatattcaactaaatggaaagagtacattagatactccttctgctaccatgtca
gcaaaagaaaaagaggcaaaattaaaatcggctgatgagaataacaagccaccgaactac
aaaagaatttctgacgatgatttatataggcactcttctcagtatagaatgtggtcatac
actaaagatcaacttcaggagaaaagggtagataccaatgcccgagcgattgcttacatt
gaggaaaatttattaaaatttagagaagcacacaatttaacagaagaagaaataaaagta
ctagaagcaaaggctatccctttgacaatggaagaagaactcgatttggtgaatttctac
gcaaaaaaagttcaggtaatagcacagcatctaaatttgccaaccgaagtagtggccact
gcgatatccttttttaggcgttttttcttagaaaattctgttatgcaaatagatcctaaa
agtattgtacatactactatctttctagcctgcaaatcggagaactattttattagcgtg
gactcgtttgctcaaaaggccaaatctactagagatagtgttctcaaattcgagtttaag
ttgttagaatcattgaaattttcactgttgaaccatcatccttacaaaccgcttcatggg
tttttcttagatatccagaacgtcctttatggtaaggttgatttaaattacatgggccaa
atatacgataggtgtaagaagagaataactgccgcattattaaccgatgtcgtatatttc
tacactccaccccaaataacactagcaacattattgattgaggatgaagccttggtcaca
aggtatttagaaacaaaatttcccagcagagaaggtagccaggaatcagtaccgggaaac
gaaaaagaagaaccacaaaatgatgccagtacaactgagaaaaacaaagagaagtccaca
gagagcgaagaatattcgatagactccgcgaagttactaaccataatacgcgagtgtaaa
agtattattgaagattgtaaacctccgagtactgaagaggccaagaaaattgcggcaaaa
aactattattgtcaaaatccatcaacactgattcagaaattaaaaaggaagttgaatgga
gaagatacttcgtccaccgttgagaaaaagcaaaaaacatga

DBGET integrated database retrieval system