KEGG   Saccharomyces cerevisiae (budding yeast): YPR066W
Entry
YPR066W           CDS       T00005                                 
Symbol
UBA3
Name
(RefSeq) NEDD8-activating protein UBA3
  KO
K10686  NEDD8-activating enzyme E1 [EC:6.2.1.64]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YPR066W (UBA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YPR066W (UBA3)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.64  E1 NEDD8-activating enzyme
     YPR066W (UBA3)
Ubiquitin system [BR:sce04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   YPR066W (UBA3)
SSDB
Motif
Pfam: ThiF DUF5058 Pyr_redox Ldh_1_N
Other DBs
NCBI-GeneID: 856179
NCBI-ProteinID: NP_015391
SGD: S000006270
UniProt: Q99344
LinkDB
Position
XVI:681213..682112
AA seq 299 aa
MDCKILVLGAGGLGCEILKNLTMLSFVKQVHIVDIDTIELTNLNRQFLFCDKDIGKPKAQ
VAAQYVNTRFPQLEVVAHVQDLTTLPPSFYKDFQFIISGLDAIEPRRFINETLVKLTLES
NYEICIPFIDGGTEGLKGHVKTIIPGITACWECSIDTLPSQQDTVPMCTIANNPRCIEHV
VEYVSTIQYPDLNIESTADMEFLLEKCCERAAQFSISTEKLSTSFILGIIKSIIPSVSTT
NAMVAATCCTQMVKIYNDLIDLENGNNFTLINCSEGCFMYSFKFERLPDCTVCSNSNSN
NT seq 900 nt   +upstreamnt  +downstreamnt
atggactgcaagatattggtgttaggcgcaggtggtctaggatgcgaaatcctgaagaat
ttgacaatgttaagctttgttaaacaggttcatattgtagatatagacacaatcgagcta
accaaccttaatagacaatttcttttttgtgataaggacataggcaaaccgaaagctcaa
gtggcagcccagtatgtaaacacgcggttccctcaattggaagttgtggcgcacgtacag
gacctgaccactttgcccccgagcttttacaaagacttccagttcataatctcggggctg
gacgccattgaacctcgtcgcttcatcaatgagactctcgtgaagcttaccttggagtcc
aattatgaaatttgcatcccgttcatagatggtggaacagaggggctcaagggacatgta
aaaacaatcattccaggcatcactgcatgctgggagtgctccattgataccttgccctcg
cagcaggatactgtgccaatgtgtacaatcgccaacaatcctcgctgcattgagcatgtt
gtggagtatgtctcaactatacaataccctgatttaaatattgagtctacggcggatatg
gaatttctgctggagaagtgctgcgaaagggctgcccaatttagcatctcaacagaaaaa
ttatcaacaagttttatcctgggtataataaagagtatcatacctagtgtaagcactacg
aatgcgatggttgcagcgacatgctgtacgcagatggttaagatttataatgatttaatc
gacctggaaaacggcaataatttcactttgattaactgctcagaagggtgttttatgtac
agtttcaagttcgagcggttacccgactgtactgtttgttcaaattccaattccaactag

DBGET integrated database retrieval system