Shewanella chilikensis: GII14_03515 Help Entry GII14_03515       CDS       T08813                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism schk  Shewanella chilikensis Pathway schk02024   Quorum sensing schk03018   RNA degradation Brite KEGG Orthology (KO) [BR:schk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GII14_03515 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GII14_03515 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:schk03019]     GII14_03515 (hfq)    03036 Chromosome and associated proteins [BR:schk03036]     GII14_03515 (hfq) Messenger RNA biogenesis [BR:schk03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GII14_03515 (hfq) Chromosome and associated proteins [BR:schk03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GII14_03515 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QIJ03338 UniProt:  A0A6G7LNH0 LinkDB All DBs Position 745891..746166 Genome browser AA seq 91 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPSRPFNVSNHQGGGQQNYNSQHDDSSEQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccattcctgaacgcactacgccgtgagcgcgtt cctgtttccatctacctggtcaacggtatcaagttgcagggacaggtggaatcttttgac cagttcgttatcttgctgaaaaacacggttagccagatggtatataagcatgccatttca actgttgtgccttctcgtccatttaatgtgagcaatcatcagggcggtggtcagcagaac tataactcgcagcacgatgatagcagcgaacagtaa

DBGET integrated database retrieval system