KEGG   Streptomyces collinus: B446_29685
Entry
B446_29685        CDS       T02787                                 

Name
(GenBank) dioxygenase
  KO
K18057  pentalenolactone F synthase [EC:1.14.11.36]
Organism
sci  Streptomyces collinus
Pathway
sci00999  Biosynthesis of various secondary metabolites - part 1
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    B446_29685
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.36  pentalenolactone F synthase
     B446_29685
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AGS72743
UniProt: S5UZH8
LinkDB
Position
6870073..6870993
AA seq 306 aa
MDVSPIPDSTVGAVVHGAAITPDLDDTTVERLWAALDQHLVLVFRGHRDPSNDELLGFGR
RFGHIPKTGLTTGASPDHNEILIISNIVENGRKIGVGDAGWMDWHTDYSFRPRVSRIGFL
AAVELPVSGGGQTLFTDMYGVYDSLPADLRRRLHSYRARHALRSGYEETIEESYQGEVSI
AGAGPGAAPATTAILPEDGTSTVHPLIARNPRTGRHAVYVNSLNTKRILELDPAASKELL
QDLWSHAGSPALTYTHTWEPGDIVMWDQLGTIHAKTAFDPGDRRILRKVVAIFDDPTEPW
RAEAAA
NT seq 921 nt   +upstreamnt  +downstreamnt
atggacgtctcgccgataccggactcgacggtcggagccgtcgtgcacggcgccgccatc
accccggacctcgacgacaccaccgtcgagcggttatgggccgcgctcgaccagcacctg
gtgctggtcttccgcggccaccgggacccctcgaacgacgaactgctcggcttcggacgc
cgtttcgggcacatcccgaagaccggtctcaccaccggcgccagccccgaccacaacgag
atcctgatcatctccaacatcgtggagaacggccgcaagatcggcgtcggcgacgccggc
tggatggactggcacaccgactactccttccggccccgggtctcccggatcggcttcctc
gccgccgtggaactgcccgtctccggcggcggccagaccctgttcaccgacatgtacggg
gtgtacgactcgctgcccgcggacctgcgccgccgcctgcactcctaccgggcccggcac
gccctgcgctccggctacgaggagaccatcgaggagagctaccagggcgaggtctccatc
gcgggcgccggccccggcgccgcacccgccaccacggcgatcctgcccgaggacggcacc
tccaccgtccacccgctgatcgcccgcaacccgcgcaccggccgccacgccgtctacgtc
aactccctcaacaccaaacgcatcctcgaactcgaccccgccgccagcaaggaactcctc
caggacctgtggagccacgccggctcgcccgccctgacctacacccacacctgggagccc
ggcgacatcgtcatgtgggaccagctcggcaccatccacgccaagacggccttcgacccc
ggcgaccggcgcatcctgcgcaaggtcgtggccatcttcgacgacccgaccgagccctgg
cgagcggaggccgcggcgtga

DBGET integrated database retrieval system