KEGG   Streptomyces clavuligerus: BB341_07790
Entry
BB341_07790       CDS       T04717                                 

Definition
(GenBank) non-ribosomal peptide synthetase
  KO
K12743  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00311  Penicillin and cephalosporin biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BB341_07790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sclf01008]
    BB341_07790
Enzymes [BR:sclf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     BB341_07790
Polyketide biosynthesis proteins [BR:sclf01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   BB341_07790
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Thioesterase
Other DBs
NCBI-ProteinID: ANW18132
UniProt: E2Q5R1
LinkDB
Position
2017030..2028375
AA seq 3781 aa
MMSARYPRTAAEWTTRIQGVSSERCDLEMLLKDEWRNRIAVRDDDPGVRATRQRDIVVDG
REYTALKDALRAADGVSAGALALASLHSVMRAYGHGEQTVAAFVDATATAELKTAAVLPV
IVDHIEHTRLTCAEAIRELDETLRRKDSYTRADEVLQRGLFDALLVLAEREVALSELPSA
PLVMVVRDDAARGRLCWTMAYAGELFEDTTVAGVLEVVREVLGQYAGRPGDRVAEIELAS
REQRERLQRWNATDGDFPADQRLNDLVEAAVRRSPDREAVVFGTQRLTYREVDARANRFA
HWLLGPGLGVRSQQLVGIFLDKSDLGVVATLGIWKAGAAYVPIDPAYPAERVRFAVGDTG
LRGIVTNRHHAGRLREILGAEHADVTVVEIESVLDEQAAADTDGLLSVKPELALGVRDLA
YLTYTSGTTGVPKGVPKYHDSVVNSITDLSERYDMRRPGTERVALFASYVFEPHLRQTLI
ALINGQTLVVVPEEVRLDPDRFPAYIEEHGVTYLNATGSVLQHFDLRRCTSLKRLLLVGE
ELTAAGLRQLRERFSGRIVNEYAFTEAAFVTAVKEFAPGVTERADRSIGRPVRNVKWYVL
SQDLKRLPVGAIGELYIGGCGVAPGYLNRDDLTAERFLTNPYASEQDRARGMNARIYRTG
DLARMLPSGEVEFMGRSDFQLKLNGVRVEPGEIEAQATEYAGVRKCVVIAREGAGGGSDR
HLVGYYLTEPGAGVTEAELLSFLERRLIRIMVPARMVRLESIPVNVNGKVDWRALPEVDL
ARPDTGGGAVGSTTTGGVRGELREIWSAVLGLPVSRIGDGDDFFRLGGQSISCILLIARI
RQRLGVFVGVEDVFTLRTLGALADRLERDRGTAPADGTPQERRSAEGTADTTGTDGAEGA
DGGPVRLLANGLQQGLLYHALKRRNGDDAYVMQSVHHYRCAIRPELMREAWQHARRTYPA
LRLRFEWAEEALQIVENDDRSVDWRFTDLSGVADPAEQDARIRELQERDRTEPYDPAAGG
LFRIYLIRRSEEFFSLLFSCHHIILDGWSLPVLHDDVHRTYLRLVDGEPVTADAGSTGTP
GSTGNTGNTGKTDTAYIAAQRDWEAHRGDHVDYWTRQIERIDERGDFGGLVREDIRYQVA
LSEYDHVKEHRTRRLALGAERTAALKAVCAEHSVTLHSVLQFVWHKVLYAVGGGNTTVVG
TIVSGRNPHIDGIENSVGLFINTLPVIVDHDEQAALGTDAAIADIQSAVTAMAARSTVEL
GRLETGGMKRRLFDTLLVLENYPRLLSEDEERAHDELLRFEKAYDADKVDYPLAVVAREE
GEELTVTLWYAGELFEDATIDTLLGVAETLFDQVAEDISRRVDRLELVSPAMVEQYGVWN
RTTAPFPAGQTLHGVFERQAAAWPDETAVVFRDRRLTYRELNERANRLAHHLRSVAELRP
NDLVGLVVDKNELMITAILAVWKTGAGYVPIDPGYPDDRVAFMLADTSAKLVITNQGRVA
RIGELTGGALPVVDLDRLPDGNGADGDPVTDVTATDLAYAIYTSGTTGRPKAVLVEHRGV
VNLQHSLAKLFGLDRSEGVEALLSFSNYVFDHFVEQMTDALLNGQKLVVLDDTMRTDAER
LYRYINDEQVTYLSGTPSVLSLYDYSTTTSLTRIDAIGEDFTEPVFNKIRAMFPGTIING
YGPTEISITSHKRPYTVGERRSTKSIGHPVDNYTAYVLNKSMQRVPVGGMGELYIGGVGV
TRGYLNRDELTADRFVDNPFQTAEERAEGRNARVYKTGDLVRWLPNGELECLGRTDLQVK
IRGQRVELGEVEAALSSYPGVTRSLVIAREHRGAGLASAQKYLVGFYVGTDDLDEQDVRQ
WMRTKLPEAVVPSRVLRITDIPVTPSGKLDVTRLPETDFGPGDSGEYIAPSNDVETKLCG
IWATVLGLAPERVGVTDDFFALGGDSLRAMVLAQAITTGFGRGLGVATVLQHTTLGAQAK
HIRESAAHGDGEQDGPVAGRAAAGDGNPPVSLAQERLLFIDEFEGGTDAYNIPFVLEIAT
GDAASTRDAVTGALRALLGRHAALRTLLRTDEHGVRRQYPLPAAEAAARFEVPLHTVADR
TALDERLVERSRTVFRLDEELPLVADLFTAGPADGRAYLSLVVHHSAFDGWSWSTFREEL
AALLRGVPVTDLRQVHGSYADFSLWQRQYLSGGRLAELTGYWTGALAGYETIRLPLDRPR
PARFDYRGREIDFDLDEGTARALRELARSARVSLYSVLLGAWALTLRVYTGQDDFVVGTP
AANRGRPEFDRTVGFFANLLALRVRVDADAGLAEYIRAVGADVVAAQVHGELPFEQLVKE
LNPEKDPSRHPVLQVNFTLQNVTDRAPVGGGAGAEPEFTEYKPDAGGFTATKFDLSATVT
ENAAGRLAGNLTYAAALFDDDTAEGFIATFRQVLAEFARLADAGEQARVAEVDPVGAAER
AALAAGPAGALQAAAAEALPAPRTLHTVFEEQAAAWPDAVAVAHGATRLTYRELNERANQ
LAHYLRSVARIRPSDLIGLVVEKSELTVVAILAVWKAGAGYLPIDPGHPDDRVTFMLADT
EARLVVTQRAHGERLRRLAGDALPVVEIDALPQGYRSTDDPVTDTTPADLAYAIYTSGTT
GRPKAVLVPHRAVDSFRATLAGRYFGPPDTGRQGVLFLANYVFDFSVEQLALSVLGGHTL
IVPPPSPAQDERFYEDANRAGLTYISGTPTQVQQFDLARLPGLRTVLVAGEAFHERHFEK
IREGWAGPILNAYGTTETAVYNTVRRFEPGDPYRNTLGLPLGNTRLYVLGDGLKPLPPGA
VGELYVAGECVTDGYLNRPELTGERFLPNPFDTGEEGREGRHPVLYRSGDLVRLTRGGEL
QYLGRNDAQLKIRGLRIEPGEVEAVLATAPGVRECAVAAVADDRSPGNTRLVGYYVAATG
TETDTDTGTGDAGGADEDAIFAVLRARLMPGMVPSLLIRMDGPLPMTINGKLDTKALPKA
ALPERRADRTAPRNRTEARLCQLWGDRLPGGTVGIDDDFFRSGGDSISALHLASQVQREI
GRRVGVKDIFDHPTVRHFAERVLAAPDRGRDPGEGGEAPEQGRLDGDCPLLPIQEWFFAK
PLADRNWWNHNFAVTAPELDVARLGQALARLVEHHDAFSLRYRSEGGGDGADERFVQRYD
AAVPEVVLHELDVRGLSPEEISERLARWQSGFDLERGPIHCAAYLHGFADGSARVWFALH
HLVVDTVSWHILAQDLEILYHGGALEEKTSSYRQWARALAAYPADEAERRLWAEAVASLA
ATAQALPVPAPGAATLREEFALDAERTTALLTECHWAYDTTINDLLLTAVGGALRAVTGL
AVNHVTVEGHGRERFDGAPDVRDTVGWFTTMHPLAVEAHPQDVGRGITATKEASRRVPHH
GIGYGALFGRYGGERAPLPPVSFNYLGRVSDAGEQTDGPSAGWRLDSAMSGSNISGRNRG
ADQFSVDVTMRCTGGRLVTAVDSRLDEETTRRFTDELRSWLERLVAHTSAVSGENGGRAR
AAERAGAGTEFDPYILVDGDRAERTLFVFPPGEGGAESYLSNLAQRLPGHRLVLFNNVHL
HRPMESFEALADFYLPLLREIQPSGPYHLLGWSFGGVLSVEVSLRLARAGERIEELFLID
PYFDVRASSAAIGLPETEDILDPINYHWAPAREDLERLRANTGDVVLFRADEPNEIVRDE
EQRRLFDFYQRSSFNGLDALLPAESIEVHRLHGETHHSWVRNDRLVADICARVSASSPDA
R
NT seq 11346 nt   +upstreamnt  +downstreamnt
atgatgtcagcacggtacccgaggaccgcagcggagtggaccactcgcattcaaggagtg
tcgagcgagcgttgcgatcttgaaatgctgctgaaggacgagtggcgcaacaggatcgcg
gtacgggacgacgaccccggtgtccgtgcgacgaggcagcgggacatcgtcgtcgacggg
cgggagtacaccgctctgaaggacgcgctgcgcgccgccgacggggtctcggcgggcgcg
ctcgcgctggcctccctgcacagcgtgatgcgcgcgtacggccatggcgagcagacggtg
gcggcgttcgtcgacgcgacggcgacggcggagctgaagacggccgccgtgctgccggtg
atcgtcgaccatatcgagcacacccggctgacctgcgccgaggcgatccgggagctggac
gagacgctgcgccgcaaggactcctacacccgtgcggacgaggtgctccagcgggggctc
ttcgatgccctgctggtgctcgccgagcgcgaggtggccctgtccgagctgccgtcggcc
ccgctggtcatggtcgtccgggacgacgcggcccggggccggctgtgctggacgatggcg
tacgcgggcgagctgttcgaggacacgacggtcgccggtgtgctggaggtcgtccgggag
gtgctcgggcagtacgccgggcggccgggcgaccgggtcgccgagatcgagctggcctcg
cgggagcagcgcgagcggcttcagcggtggaacgcgaccgatggcgacttcccggcggac
cagcgcctcaacgacctggtcgaggcggccgtgcggcggtcgccggaccgtgaggcggtc
gtcttcgggacacagcggctgacctatcgggaggtcgacgcgcgggcgaaccggttcgcg
cactggctgctcggtccgggtctcggggtccgttcgcagcagctcgtcgggatctttctg
gacaagagcgatctcggggtggtcgccacgctcggcatctggaaggcgggcgcggcctat
gtgccgatcgacccggcctatccggcggagcgggtgcggttcgcggtcggtgacaccggg
ctgcggggcatcgtcaccaaccggcaccacgcggggcggctgcgggagatcctgggcgcg
gagcacgcggatgtgacggtcgtcgagatcgagtccgtgctcgacgagcaggccgccgcc
gacaccgacggcctgctgagtgtgaagcccgagctggcgctgggggtacgggatctggcc
tatctcacctacacctccggcaccaccggtgtgccgaagggggtgcccaagtaccacgac
agtgtcgtgaacagcatcacggacctgtcggagcggtacgacatgcggcggccgggcacg
gagcgggtcgcgctcttcgcctcgtacgtcttcgagccgcatctgcggcagacgctgatc
gcgctcatcaacgggcagacgctggtcgtcgtccccgaggaggtccggctcgacccggac
cgcttccccgcgtacatcgaggagcacggcgtcacgtacctcaacgcgacgggttcggtg
ctgcaacacttcgatctgcgccgatgtaccagcctgaaacggctgttgctggtcggcgag
gagctgacggcggccgggctgcgccagctccgcgagcggttctccgggcggatcgtcaac
gagtacgccttcaccgaggcggcgttcgtcaccgccgtgaaggagttcgcgccgggcgtc
accgagcgcgcggaccgcagcatcggccgaccggtgcggaatgtgaagtggtatgtcctc
agccaggatctgaagcggttgccggtcggggcgatcggcgagctgtacatcggcggctgc
ggggtggcgccgggctatctgaaccgcgacgacctgacggccgagcggttcctgaccaat
ccgtacgcctcggagcaggaccgggcgcgcgggatgaacgcccggatctaccggaccggt
gacctggcgcggatgctgccgtccggcgaggtcgagttcatgggccgcagcgacttccag
ctcaagctgaacggtgtccgggtggagccgggcgagatcgaggcgcaggccaccgagtat
gcgggggtccgcaagtgcgtggtcatcgcccgtgagggggcgggcggcggcagcgaccgc
catctggtcggctactacctgacggagcccggggccggggtgaccgaggcggagctgctg
tccttcctggagcggcggctcatccggatcatggtcccggcgcggatggtccggctggag
agcatccccgtcaatgtcaacggcaaggtcgactggcgggcgctgcccgaggtggacctc
gcccgcccggacacgggcggcggcgcggtgggctccaccacgaccgggggtgtccggggt
gagctgcgcgagatctggagcgcggtcctcggccttccggtgtcccgtatcggcgacggc
gacgacttcttccggctcggcggccagagcatctcctgcattctgctcatcgcccggata
cggcagcggctgggcgtcttcgtcggggtcgaggacgtcttcacgctgaggacgctgggc
gcgctggcggaccggctggagcgcgaccggggcacggcgcccgcggacggcacgccgcag
gagcggcggtccgccgagggcacagcggacacgacgggcacggacggtgcggagggcgcg
gacggcgggcccgtgcggctgctcgcgaacggtctccagcaggggctgctctaccacgcc
ctgaagcgccgcaacggcgacgacgcctatgtgatgcagtcggtgcaccactaccgctgc
gccatccgccccgagctgatgcgcgaggcgtggcagcacgcgcggcgcacgtaccccgcg
ctgcggctgcgtttcgagtgggccgaggaggccctccagatcgtcgagaacgacgaccgt
tccgtggactggcggttcaccgatctgagcggggtggccgacccggcggagcaggacgcc
cggatccgggagctccaggagcgggaccggaccgagccctacgacccggcggcgggcggg
ctgttccggatctatctgatccgccggagcgaagagttcttctcgctgctgttcagctgc
caccacatcatcctggacggctggagcctgccggtcctccacgacgacgtgcaccggacc
tatctgcggctggtggacggcgagccggtcacggcggacgcggggagcaccggtaccccc
gggagcaccgggaacaccgggaacaccgggaagacggacaccgcgtacatcgcggcgcag
cgggactgggaggcgcaccgcggcgaccacgtcgactactggacccgtcagatcgagcgg
atcgacgagcggggcgacttcggcgggctggtccgggaggacatccgctaccaggtggcg
ctgagcgagtacgaccacgtcaaggagcaccggacccggcggctcgccctcggtgccgag
cggaccgcggcgctgaaggcggtctgcgcggagcactccgtgaccctgcactcggtgctc
cagttcgtgtggcacaaggtgctgtacgccgtcggcggcgggaacaccacggtggtcggc
acgatcgtgtccgggcgcaatccgcacatcgacgggatcgagaactccgtcggtctgttc
atcaacacgctgcccgtgatcgtcgaccacgacgagcaggcggcgctgggcacggacgcg
gccatcgcggacatccagtccgccgtgaccgccatggccgcccggagcacggtggagctg
ggccggctggagaccggcgggatgaagcgccgcctcttcgacaccctgctggtcctggag
aactatccgcggctgctctccgaggacgaggagcgcgcccacgacgagttgctgcgcttc
gagaaggcgtacgacgccgacaaggtcgactatccgctggccgtggtcgcccgcgaggag
ggtgaggagctgaccgtcaccctctggtacgcgggtgagctgttcgaggacgccacgatc
gacaccctgctcggggtggcggagaccctgttcgaccaggtggccgaggacatctcgcgc
cgggtggaccggctggagctggtctcgcccgcgatggtcgagcagtacggggtgtggaac
cggaccacggccccgttcccggccgggcagaccctgcacggggtcttcgagcggcaggcc
gccgcctggccggacgagaccgcggtggtcttccgcgaccggcggctgacctaccgggag
ctgaacgagcgcgccaaccggctggcgcaccatctgcgctcggtcgcggagctgcgcccg
aacgacctggtcggcctggtcgtcgacaagaacgagctgatgatcaccgcgatcctggcg
gtgtggaagacgggcgcgggctatgtcccgatcgacccgggctaccccgacgaccgggtg
gcgttcatgctggcggacaccagcgccaagctggtgatcaccaaccaggggcgggtggcg
cggatcggggagctgaccggtggcgcgctgccggtggtggatctcgaccggctgcccgac
ggcaacggcgcggacggcgacccggtcaccgatgtcaccgccacggatctcgcgtacgcg
atctacacctccggcaccaccggcaggcccaaggcggtgctggtcgagcaccggggtgtg
gtgaacctccagcactcgctggcgaagctgttcggcctggaccggagcgagggcgtcgag
gcgctgctgtcgttctcgaactacgtcttcgaccacttcgtggagcagatgacggacgcc
ctgctcaacgggcagaagctggtcgtcctcgacgacaccatgcgcacggacgccgagcgg
ctgtaccggtacatcaacgacgagcaggtcacctatctctccggcacgccgtcggtgctc
tcgctctacgactactcgacgacgacctcgctgacccggatcgacgcgatcggcgaggac
ttcaccgagccggtcttcaacaagatccgcgccatgttcccggggacgatcatcaacggg
tacgggccgacggagatctcgatcaccagccacaagcggccctacacggtcggcgagcgg
cggtcgacgaagagcatcggccacccggtggacaactacacggcctatgtcctgaacaag
tcgatgcagcgggtgccggtcggcggcatgggcgagctgtacatcggcggtgtcggcgtc
acccgcggctatctgaaccgcgacgagctgacggcggaccgcttcgtcgacaaccccttc
cagaccgccgaggagcgggccgaggggcgcaacgcgcgcgtctacaagaccggtgacctg
gtgcgctggctgcccaacggcgagctggagtgcctgggccgcaccgacctccaggtcaag
atccggggacagcgggtcgagctgggcgaggtcgaggccgcgctctcctcgtacccgggc
gtcacccgttccctggtcatcgcgcgggagcaccggggcgcggggctcgcgtcggcgcag
aagtacctcgtgggcttctatgtcggcacggacgatctggacgagcaggacgtcaggcag
tggatgcggacgaagctgcccgaggcggtcgtcccctcccgggtgctgcggatcaccgac
atcccggtgacgccgagcggcaagctggacgtcacacggctcccggagaccgacttcggc
ccgggtgacagcggcgagtacatcgcgccgtcgaacgatgtcgagaccaagctgtgcggc
atctgggccacggtgctcggtctcgccccggagcgggtcggcgtcaccgacgacttcttc
gccctcggcggcgacagcctccgggcgatggtgctggcgcaggccatcaccaccggcttc
ggccggggtctcggggtcgcgaccgtgctccagcacacgaccctcggggcgcaggcgaag
cacatccgcgagagcgccgcgcacggcgacggggagcaggacgggccggtcgcgggccgg
gccgcggcgggcgacggaaacccgccggtgtcgctcgcgcaggaacgtctgctgttcatc
gacgagttcgagggcggcaccgacgcctacaacatccccttcgtcctggagatcgcgacc
ggggacgccgcctcgacccgggacgcggtcaccggggcgctgcgcgccctgctggggcgg
cacgcggcgctgcgcaccctgctgcggaccgacgagcacggcgtccggcggcagtacccg
ctgcccgccgccgaggccgcggcccggttcgaggtcccgctgcacacggtcgcggaccgc
acggccctggacgagcggctggtggagcggtcccgcacggtcttccggctggacgaggag
ctgccgctcgtggccgacctcttcacggccggtccggcggacggccgcgcgtatctgagt
ctggtcgtccaccacagcgccttcgacggctggtcgtggagcaccttccgggaggagctg
gcggccctgctgcgcggtgtccccgtgacggatctgcggcaggtccacggcagctacgcc
gacttctcgctgtggcagcggcagtatctgtccgggggcaggctggcggagctgaccggg
tactggacgggggcgctggccgggtacgagacgatccggctgccgctggaccgcccgcgt
ccggcgcgcttcgactaccggggccgggagatcgacttcgacctcgacgaggggacggcg
cgggcgctgcgcgagctggcgcggtccgcgcgggtgagcctgtacagcgtgctgctcggc
gcgtgggcgctcaccctgcgcgtctacaccggccaggacgacttcgtcgtgggcacgccc
gccgcgaaccgggggcgcccggagttcgaccggaccgtcggcttcttcgcgaacctgctg
gcgctgcgggtccgggtcgacgcggacgccggtctcgcggagtacatccgcgcggtcggc
gcggacgtggtcgcggcccaggtccacggcgagctgccgttcgagcagctcgtgaaggag
ctgaacccggagaaggacccgagccggcaccccgtgctccaggtcaacttcaccctccag
aacgtcaccgaccgcgctcccgtcggcggcggggccggggcggagccggagttcaccgag
tacaagccggacgccgggggcttcacggccaccaagttcgatctgtcggcgacggtcacc
gagaacgccgcggggcggctcgcgggcaacctcacctacgccgccgcgctcttcgacgac
gacaccgccgaagggttcatcgccaccttccggcaggtcctcgcggagttcgcgcggctc
gcggacgccggggagcaggccagggtcgcggaggtggacccggtcggcgcggcggagcgc
gcggccctcgcggccggtcccgccggggccctccaggccgcggccgccgaggcgctgccc
gccccccggaccctgcacacggtcttcgaggagcaggccgccgcctggccggacgccgtc
gcggtcgcccacggcgcgacccggctcacctaccgggagctgaacgagcgcgccaaccag
ctcgcgcactatctgcgctccgtggcgcggatccgtccgagcgatctgatcggcctggtc
gtcgagaagagcgagctgaccgtcgtcgcgatcctcgcggtgtggaaggcgggcgcgggc
tatctgccgatcgacccgggccaccccgacgaccgggtgaccttcatgctggcggacacc
gaggcccggctggtggtcacccagcgggcccacggggagcggctgcgccgcctcgcgggc
gacgcgctgccggtggtggagatcgacgcgctgccgcagggctaccgctcgaccgacgac
ccggtcacggacaccaccccggcggacctcgcgtacgcgatctacacctcgggcaccacc
ggccgccccaaggcggtgctggttccgcaccgcgcggtggacagcttccgcgcgacgctg
gccggacggtacttcggcccgcccgacaccggccgccagggggtgctgttcctcgccaac
tatgtcttcgacttctcggtggagcagctcgcgctgtccgtcctcggcggtcacaccctg
atcgtcccgccgccgtcgcccgcgcaggacgagcggttctacgaggacgcgaaccgcgcc
gggctgacgtacatcagcgggacgcccacccaggtccagcagttcgacctggcgcggctg
ccggggctgcgcacagtgctggtcgccggtgaggcgttccacgagcgccacttcgagaag
atccgcgagggctgggcggggccgatcctcaacgcgtacggcaccaccgagacggccgtc
tacaacaccgtccggcgcttcgagccgggtgacccctaccgcaacaccctgggtctgccg
ctcgggaacacccggctgtacgtcctcggcgacgggctgaagccgctgccgccgggcgcg
gtcggcgagctgtatgtggccggtgagtgtgtgacggacggctatctcaaccggccggag
ctgaccggtgagcgcttcctgccgaacccgttcgacaccggggaggaggggcgggagggc
cgccacccggtcctctaccgcagtggcgacctggtccggctgacccgcggcggcgagctc
cagtacctgggccgcaacgacgcccagctcaagatccgcgggctgcggatcgagccgggc
gaggtggaggcggtcctcgccaccgctccgggggtccgcgagtgcgcggtcgccgccgtg
gccgacgaccgctccccggggaacacccggctggtcggctactacgtcgccgccaccggc
acggagacggacacggacaccggcacgggcgacgccgggggcgccgacgaggacgcgatc
ttcgcggtgctgcgggcgcggctgatgccgggcatggtgccctcgctgctgatccgcatg
gacggcccgctgccgatgaccatcaacggcaagctggacaccaaggcgctgccgaaggcg
gcgctgccggagcggcgcgcggaccgcacggccccgcgcaaccggaccgaggcccggctg
tgccagctctggggcgaccggctccccggtggcacggtcggcatcgacgacgacttcttc
cgctcgggcggcgacagcatcagcgccctgcacctggcgagccaggtgcagcgggagatc
gggcgcagggtcggcgtcaaggacatcttcgaccatccgaccgtccggcacttcgccgag
cgggtgctggccgccccggaccgggggcgggaccccggcgagggcggcgaggcgcccgag
cagggccggctggacggtgactgtccgctgctgcccatccaggagtggttcttcgccaag
ccgctcgccgaccggaactggtggaaccacaacttcgccgtcaccgccccggagctggac
gtggcgaggctgggccaggcgctggcgcggctggtcgagcaccatgacgcgttcagcctg
cggtaccgctccgagggcggcggcgacggcgcggacgagcggttcgtccagcgctacgac
gccgccgtgcccgaggtcgtcctgcacgagctggatgtgcgcgggctctcccccgaggag
atctccgaacggctcgcccgctggcagagcggcttcgacctggagcgcggaccgatccac
tgcgcggcctatctgcacggcttcgccgatggctcggcccgggtctggttcgccctgcac
cacctggtcgtcgacaccgtgagctggcacatcctcgcgcaggacctggagatcctgtac
cacgggggcgcgctggaggagaagacgagcagctaccgccagtgggcgcgggcgctcgcc
gcgtacccggcggacgaggccgagcggcggctgtgggcggaggccgtcgcgtccctggcg
gccaccgcacaggcgctgccggtcccggcgccgggcgcggcgacgctccgggaggagttc
gcgctcgacgcggagcggaccacggcgctgctgaccgagtgccactgggcgtacgacacc
accatcaacgatctgctgctgacggcggtcgggggcgcgctgcgggccgtcaccggcctg
gcggtcaaccatgtcaccgtggagggccacggccgggagcggttcgacggggcgcccgac
gtccgggacacggtgggctggttcacgaccatgcacccgctggccgtggaggcgcacccg
caggacgtggggcgcggcatcaccgccacgaaggaggcttcccggcgggtgccgcaccac
ggcatcggatacggggccctcttcggccgctacggcggggagcgggcgccgctgccgccg
gtgagcttcaactacctcggccgggtctccgacgccggggagcagacggacgggccctcc
gcgggctggcggctcgactcggcgatgtcggggagcaacatctccggccgcaaccggggc
gccgaccagttcagtgtggacgtgaccatgcgatgtaccggcggccggctcgtcaccgcg
gtggacagccgactggacgaggagaccacccggcgcttcacggacgagctgaggagctgg
ctggagcggctcgtcgcccacacctcggcggtgtcgggcgagaacggcggccgggcgcgc
gccgccgagcgggccggggccgggacggagttcgacccgtacatcctcgtcgacggggac
cgcgccgagcgcaccctcttcgtcttcccgcccggtgagggcggcgccgagagctatctg
agcaatctcgcgcagcggctgcccggccaccggctggtgctcttcaacaatgtgcatctg
caccggccgatggagtccttcgaggcgctggccgacttctatctccccctcctccgggag
atccagccgtccggcccgtaccacctgctgggctggagcttcggcggggtgctctcggtg
gaggtctcgctccggctggcccgggcgggcgagcggatcgaggagctgttcctcatcgac
ccgtacttcgacgtccgggcctcgtcggcggcgatcgggctgccggagaccgaggacatc
ctcgatccgatcaactaccactgggcgcccgcccgggaggatctggagcggctgcgcgcg
aacaccggcgatgtggtgctgttccgggcggacgagccgaacgagatcgtccgggacgag
gagcagcgccggctgttcgacttctaccagcggtcctccttcaacgggctggacgcgctg
ctgcccgcggagtccatcgaggtccaccggctgcacggtgagacccaccattcgtgggta
cgaaacgaccggctggtcgccgacatctgtgcgcgtgtctcggcgtcgtcgccggatgcc
cggtga

DBGET integrated database retrieval system