KEGG   Streptomyces clavuligerus: BB341_07795
Entry
BB341_07795       CDS       T04717                                 

Definition
(GenBank) penicillin synthase
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00311  Penicillin and cephalosporin biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BB341_07795
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     BB341_07795
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-ProteinID: ANW18133
UniProt: B5GLC3
LinkDB
Position
2028407..2029396
AA seq 329 aa
MPVLMPSAHVPTIDISPLFGTDAAAKKRVAEEIHGACRGSGFFYATNHGVDVQQLQDVVN
EFHGAMTDQEKHDLAIHAYNPDNPHVRNGYYKAVPGRKAVESFCYLNPDFGEDHPMIAAG
TPMHEVNLWPDEERHPRFRPFCEGYYRQMLKLSTVLMRGLALALGRPEHFFDAALAEQDS
LSSVSLIRYPYLEEYPPVKTGPDGQLLSFEDHLDVSMITVLFQTQVQNLQVETVDGWRDI
PTSENDFLVNCGTYMAHVTNDYFPAPNHRVKFVNAERLSLPFFLNGGHEAVIEPFVPEGA
SEEVRNEALSYGDYLQHGLRALIVKNGQT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgccagttctgatgccgtcggcccacgttccgaccatcgacatctcgccgctgttcgga
accgacgccgccgcgaagaagcgcgtcgccgaggagatacacggggcctgccgcggctcg
ggcttcttctacgccacgaaccacggcgtggacgtccagcagctccaggacgtggtgaac
gagttccacggcgccatgaccgaccaggagaagcacgacctggcgatccacgcgtacaac
ccggacaacccgcatgtgcgcaacggctactacaaggcggtcccgggcaggaaggccgtc
gagtccttctgttacctcaacccggacttcggcgaggaccacccgatgatcgccgcgggg
acgccgatgcacgaggtgaacctctggcccgacgaggagcggcacccgcgcttccggccg
ttctgcgagggctactaccggcagatgctgaagctctccaccgtgctcatgcgggggctg
gcgctggcgctcgggaggccggagcacttcttcgacgcggcgctcgccgagcaggactcc
ctgtcgtccgtctcgctgatccgctacccgtatctggaggagtacccgccggtgaagacg
ggtcccgacggccagctcctgagcttcgaggaccatctggacgtctcgatgatcaccgtg
ctcttccagacccaggtgcagaacctccaggtggagacggtcgacggctggcgggacatc
ccgacgtcggagaacgacttcctggtcaactgcggtacctacatggcgcatgtcacgaac
gactacttcccggcgcccaaccaccgggtgaagttcgtgaacgcggagcggctgtccctg
ccgttcttcctcaacggcgggcacgaggcggtcatcgagccgttcgtgccggagggcgcg
agcgaggaggtgaggaacgaggccctgtcctacggggactacctccagcacgggctgcgg
gcgctgatcgtcaagaacggccagacctga

DBGET integrated database retrieval system