KEGG   Streptomyces clavuligerus: BB341_07805
Entry
BB341_07805       CDS       T04717                                 
Name
(GenBank) decarboxylase
  KO
K12673  N2-(2-carboxyethyl)arginine synthase [EC:2.5.1.66]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00331  Clavulanic acid biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    BB341_07805
Enzymes [BR:sclf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.66  N2-(2-carboxyethyl)arginine synthase
     BB341_07805
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-ProteinID: ANW18135
UniProt: B5GLC6
LinkDB
Position
2031653..2033374
AA seq 573 aa
MSRVSTAPSGKPTAAHALLSRLRDHGVGKVFGVVGREAASILFDEVEGIDFVLTRHEFTA
GVAADVLARITGRPQACWATLGPGMTNLSTGIATSVLDRSPVIALAAQSESHDIFPNDTH
QCLDSVAIVAPMSKYAVELQRPHEITDLVDSAVNAAMTEPVGPSFISLPVDLLGSSEGID
TTVPNPPANTPAKPVGVVADGWQKAADQAAALLAEAKHPVLVVGAAAIRSGAVPAIRALA
ERLNIPVITTYIAKGVLPVGHELNYGAVTGYMDGILNFPALQTMFAPVDLVLTVGYDYAE
DLRPSMWQKGIEKKTVRISPTVNPIPRVYRPDVDVVTDVLAFVEHFETATASFGAKQRHD
IEPLRARIAEFLADPETYEDGMRVHQVIDSMNTVMEEAAEPGEGTIVSDIGFFRHYGVLF
ARADQPFGFLTSAGCSSFGYGIPAAIGAQMARPDQPTFLIAGDGGFHSNSSDLETIARLN
LPIVTVVVNNDTNGLIELYQNIGHHRSHDPAVKFGGVDFVALAEANGVDATRATNREELL
AALRKGAELGRPFLIEVPVNYDFQPGGFGALSI
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgtcccgtgtatcgaccgcccccagcggcaagcctaccgccgctcacgccctcctgtca
cggttgcgtgatcacggtgtggggaaggtgtttggggttgtcggccgagaggccgcgtcg
attctcttcgacgaggtcgaggggatcgacttcgttctgacccgccacgagttcaccgcg
ggtgtcgccgctgatgtcctcgcgcggatcaccggtcgcccccaggcgtgctgggccacc
ctgggccccggtatgaccaacctctccaccggtatcgccacgtccgtcctggaccgctcg
ccggtcatcgcgctcgccgcgcagtcggagtcgcacgacatcttcccgaacgacacccac
cagtgcctggactcggtggcgatcgtcgccccgatgtccaagtacgccgtggagctccag
cggccccacgagatcaccgacctcgtcgactccgccgtgaacgcggccatgaccgagccg
gtcgggccctccttcatctccctcccggtggacctgctcggctcctccgagggcatcgac
accaccgtccccaacccgccggcgaacaccccggcgaaaccggtcggcgtcgtcgccgac
ggctggcagaaggccgccgaccaggccgccgccctgctcgccgaggccaagcacccggtg
ctcgtcgtcggagcggccgcgatccgctcgggcgccgtcccggcgatccgcgccctggcc
gagcgcctgaacatcccggtcatcacgacctacatcgccaagggtgtcctgccggtcggc
cacgagctgaactacggcgccgtcaccggctacatggacggcatcctcaacttcccggcg
ctccagaccatgttcgccccggtggacctcgtcctcaccgtcggctacgactacgccgag
gacctgcgcccgtccatgtggcagaagggcatcgagaagaagaccgtccgtatctccccg
acggtcaacccgatcccccgggtctaccggcccgacgtcgacgtcgtcaccgacgtcctc
gccttcgtggagcacttcgagaccgcgaccgcctccttcggggccaagcagcgccacgac
atcgagccgctgcgcgcccggatcgcggagttcctggccgacccggagacctacgaggac
ggcatgcgcgtccaccaggtcatcgactccatgaacaccgtcatggaggaggccgccgag
cccggcgagggcacgatcgtctccgacatcggcttcttccgtcactacggtgtgctcttc
gcccgcgccgaccagcccttcggcttcctcacctcggcgggctgctccagcttcggctac
ggcatccccgccgccatcggcgcccagatggcccgcccggaccagccgaccttcctcatc
gcgggtgacggcggcttccactccaacagctccgacctggagaccatcgcccggctcaac
ctgccgatcgtgaccgtcgtcgtcaacaacgacaccaacggcctgatcgagctgtaccag
aacatcggtcaccaccgcagccacgacccggcggtcaagttcggcggcgtcgacttcgtc
gcgctcgccgaggccaacggtgtcgacgccacccgcgccaccaaccgcgaggagctgctc
gcggccctgcgcaagggtgccgagctgggtcgtccgttcctcatcgaggtcccggtcaac
tacgacttccagccgggcggcttcggcgccctgagcatctga

KEGG   Streptomyces clavuligerus: BB341_29465
Entry
BB341_29465       CDS       T04717                                 
Name
(GenBank) decarboxylase
  KO
K12673  N2-(2-carboxyethyl)arginine synthase [EC:2.5.1.66]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00331  Clavulanic acid biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    BB341_29465
Enzymes [BR:sclf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.66  N2-(2-carboxyethyl)arginine synthase
     BB341_29465
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M CO_dh SRP54 E1_dh
Other DBs
NCBI-ProteinID: ANW22449
UniProt: Q6TA05
LinkDB
Position
pSCL4:410160..411827
AA seq 555 aa
MATTTAKAMLERLHQYGVDHVFGVVGREASAILFDEVEGLDFVLTRHEFTAGVMADVLAR
ITNRPQACFATLGPGMTNLATGVATSALDRSSVIALAAQSESYDCYPNVTHQCLDSTAVM
GPLTKFSVQLERGEDIVNLVDSAVLNSRIEPVGPSFISLPVDLLGAELNGTPTDAPLVRA
TATHALDADWRARLDEAAELVREAENPLLVVGSAVIRAGAVDALRALAERLNIPVVTTYT
AKGVLPHDHPLNYGAISGYMDGILGHPALDEIFGPADLLLAIGYDYAEDLRPSMWTRGRA
KTTVRVAPEVNPIPELFRADIDIVTNVAEFVTALDDATSGLAPKTRHDLSALRARVAEFL
ADPTEYEDGMRVHQVIDCMNSVLDNGTFVSDIGFFRHYGVLFAKSDQPYGFLTSAGCSSF
GYGLPAAMAAQIARPGEPVFLIAGDGGFHSNSADIETAVRLGLPIVMVVVNNDRNGLIEL
YQNLGHQRSHAPAVGFGSVDFVQLAEANGCEAVRATDRTSLLAALTKGAGLGRPFLIEVP
VAYDFQSGGFAALAI
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggccaccacgaccgcgaaagccatgctggaacgtcttcaccagtacggtgtcgaccat
gtattcggcgtcgtcggccgggaggcgtccgccattctcttcgacgaggtcgaaggactc
gacttcgtcctgacccggcacgagttcaccgccggggtgatggcggacgtcctcgcccgg
atcaccaaccgcccccaggcgtgcttcgcgaccctgggccccggcatgaccaacctggcc
accggcgtcgccacctccgccctggaccgcagctcggtcatcgcgctggccgcgcagtcc
gagtcgtacgactgctaccccaacgtcacccaccagtgcctggacagcaccgccgtgatg
ggcccgctgaccaagttcagcgtccagctcgaacgcggcgaggacatcgtcaacctcgtc
gacagcgccgtcctcaacagccggatcgagcccgtgggtcccagcttcatcagcctgccg
gtcgacctcctcggcgccgagctgaacggcacccccaccgacgcccccctggtccgggcc
accgccacccacgccctggacgccgactggcgcgcccgcctcgacgaggccgctgagctg
gtgcgcgaggccgagaaccccctcctcgtcgtcggtagcgccgtcatccgcgccggggcc
gtcgacgccctgcgcgccctcgccgagcggctgaacatccccgtcgtcaccacctacacc
gccaagggcgtcctgccgcacgaccacccgctcaactacggcgccatcagcggctacatg
gacggcattctcggccacccggccctcgacgagatcttcggccccgccgacctcctcctg
gcgatcggctacgactacgccgaggacctgcgcccctccatgtggacgcggggccgggcc
aagaccacggtccgggtcgcccccgaggtcaacccgatcccggagctgttccgcgccgac
atcgacatcgtcaccaacgtcgccgaattcgtcaccgcgctcgacgacgcgacctcgggc
ctcgcccccaagacccggcacgacctcagcgccctgcgcgcccgcgtcgccgaattcctc
gccgaccccaccgagtacgaggacggcatgcgggtccaccaggtgatcgactgcatgaac
tccgtcctcgacaacggcaccttcgtcagcgacatcggcttcttccgccactacggcgtg
ctcttcgccaagtccgaccagccgtacggattcctcacctccgcgggctgctccagcttc
ggctacggactgcccgccgccatggccgcccagatcgcccggcccggcgagcccgtcttc
ctcatcgcgggcgacggcggcttccactccaacagcgccgacatcgagacggccgtgcgc
ctgggcctgccgatcgtcatggtcgtcgtcaacaacgaccgcaacggcctgatcgagctg
taccagaacctcggacaccagcgctcccacgcccccgccgtcggcttcggaagcgtcgac
ttcgtccagctcgccgaggccaacggctgcgaggccgtccgcgccaccgaccgcacctcg
ctgctcgccgccctcaccaagggcgccggactcggccgcccgttcctgatcgaggtaccg
gtggcctacgacttccagtccggcggtttcgccgccctggccatctga

DBGET integrated database retrieval system