KEGG   Streptomyces clavuligerus: BB341_07815
Entry
BB341_07815       CDS       T04717                                 

Name
(GenBank) agmatinase
  KO
K12676  proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00331  Clavulanic acid biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    BB341_07815
Enzymes [BR:sclf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.22  proclavaminate amidinohydrolase
     BB341_07815
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-ProteinID: ANW18137
UniProt: B5GLC8
LinkDB
Position
2035091..2036032
AA seq 313 aa
MERIDSHVSPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSES
GLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGD
HSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQ
IGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVD
PAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAE
LLYQYARAHRTQL
NT seq 942 nt   +upstreamnt  +downstreamnt
gtggagcgcatcgactcgcacgtttcaccccgctacgcacagatccccaccttcatgcgc
ctgccgcacgatccccagccccgcggctatgacgtggtggtcatcggagccccctacgac
gggggcaccagctaccgtcccggcgcccggttcggcccccaggccatccgcagtgagtcg
ggcctcatccacggtgtcggcatcgaccggggccccggcacgttcgacctgatcaactgt
gtcgacgccggggacatcaatctgacgccgttcgacatgaacatcgcgatcgacacggcg
cagagccatctgtcgggcctgctgaaggccaacgccgcctttctgatgatcggcggcgac
cactcgctgacggtggccgccctgcgcgcggtcgcggagcagcacggcccgctcgccgtg
gtgcacctggacgcgcactccgacaccaacccggccttctacgggggccggtaccaccac
ggcacccccttccggcacgggatcgacgagaagctgatcgacccggcggcgatggtccag
atcggcatccggggccacaacccgaagccggactcgctcgactacgcccggggccacggc
gtccgggtggtcacggcggacgagttcggcgagctgggggtgggcgggaccgccgacctc
atccgcgagaaggtcggccagcggcccgtgtacgtctcggtcgacatcgacgtggtcgac
cccgccttcgcccccggtacgggcacgcccgcgccgggcgggctcctctcgcgcgaggtg
ctggcgctgctgcgctgcgtgggtgacctgaagccggtcggcttcgacgtgatggaggtg
tcacccctctacgaccacggcgggatcacttcgatcctggccacggagatcggtgcggaa
ctgctctaccagtacgcccgagcccacagaacccagttgtga

DBGET integrated database retrieval system