KEGG   Streptomyces coelicolor: SCO5896
Entry
SCO5896           CDS       T00085                                 
Symbol
redH, SC10A5.01, SC3F7.16
Name
(RefSeq) phosphoenolpyruvate-utilizing enzyme
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
sco  Streptomyces coelicolor
Pathway
sco00333  Prodigiosin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SCO5896 (redH)
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-GeneID: 1101338
Kitasato: SCO5896
UniProt: Q8CJQ2
LinkDB
Position
6459417..6462218
AA seq 933 aa
MDTHVSDTTTPAGAGEGPAGPVTDPAGHAACVVTLGAGGPTGGHRGELGGKGTRLAELSA
AGLPVPPAFCLTTALFDAYLRETGIAAEAAGADPRTLRERILGTRMPASIADAVLDAYGS
MGRPRVAVRSSGLREDSAAQSFAGQHDTVLDVCGDEDVLDAVLRCWASLWSDRATVYRDT
DAPDALAVVVQEMIHTDVSGVMFTVDPVNPRPHRLVVEACQGLGEGLVSGQVSSDFFVVD
DEKLEVVEERVRYKVTKCAPLEPGRIGMTKVDAAARSVPCLTHDQLRELGALAVRIRDLY
GSEQDIEWGVRDGVFHLFQTRPITTRPAAPAAPSGALSPYVAPQPEPVLNGTLWSRMDIG
EIFVGLMTPLGLSFARYYQRNVHTDCAGALGVRDTGEADLHMGFYQGHVYLNISYSSYLL
AQCLPTRDQRHFTSRFVSEEVDLADYENPFGTFPGGMEDLLSTVHWLQHTAREMTQMKSR
SQQMVDARLYEFDRARGLDLTRMSRRELHGELHRDLAWFHDMHIGYMPYYINAFAFYGLL
TELCARWLGSDGVGLQNRVKTDMSSLRTVESAKEVWSVAQAAKNDPAVLRIIKDEPLEDI
ARLLREDPAGQRFWDRHMEPFLRANGTRGHQEMEITHPRWIDDPSYIFQMIRRYVADGFS
IDDILRRSSGWSDDSREVLGRLPMPKRQVLDTVISLYALCSELRETTRMSMITSIWLVRN
VVYEVGRRLVADGVLHSPDEIAHLDFEDVRRYLAGDEDAVRVFDRARIDAARRLHEHNKR
LPEPPLTFVGVHDITASVRPAADGARLEGLAASPGRIVGRARIVEDLVWQADEFEAGEIL
VTGYTDASWTPLFAIAGGVVTDIGSMLSHSSIVAREFHVPSVVNTKDATQRINTGDLIVV
DGDAGTVEVVESADTDPQGPAGAAGTPAGATTD
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggacacgcacgtcagcgacacgacgacccccgccggagcaggcgaaggccccgccggc
ccggtcaccgacccggccgggcacgccgcctgcgtcgtcaccctgggcgcgggcggcccg
accggaggccaccggggggaactgggcggcaagggcacccgcctcgcggagctgtccgcc
gcgggtctgcccgtcccgcccgccttctgcctgaccaccgccctcttcgacgcctacctg
cgggagaccgggatcgccgccgaggcggcgggcgccgacccccgcaccctgcgcgagcgc
atcctgggcacccggatgcccgcctcgatcgcggacgccgtcctcgacgcctacggcagc
atgggccgcccccgcgtggcggtgcgctcctccggactgcgggaggactccgctgcacag
tccttcgccggccagcacgacacggtcctcgacgtctgcggcgacgaggacgtactggac
gcggtcctgcggtgctgggcctcgctgtggtccgaccgcgccacggtgtaccgggacacg
gacgcccccgacgccctcgccgtggtcgtccaggagatgatccacaccgacgtcagcggc
gtgatgttcaccgtcgacccggtcaacccccgcccgcaccgcctcgtggtggaggcctgc
cagggcctgggcgaagggctggtctccgggcaggtctccagcgacttcttcgtcgtcgac
gacgagaagctggaggtcgtcgaggaacgggtccgctacaaggtcaccaagtgcgcgccc
ctggagcccggccgcatcggcatgacgaaggtcgacgcggcggcccgcagcgtcccctgc
ctcacccacgaccaactgcgcgaactcggcgccctggccgtccgcatccgcgacctgtac
ggcagcgagcaggacatcgagtggggcgtgcgcgacggcgtcttccacctgttccagacc
cgcccgatcaccacccggcccgccgcccccgcggccccgtccggcgcgctcagcccgtac
gtcgccccgcagccggagccggtcctcaacggcaccctgtggtcgcgcatggacatcggg
gagatcttcgtcggcctgatgaccccgctcggcctgagcttcgcccgctactaccagcgc
aacgtgcacaccgactgcgcgggcgccctcggcgtgcgcgacaccggcgaggccgacctg
cacatgggcttctaccagggccacgtctacctcaacatctcctacagctcctacctgttg
gcccagtgcctgcccacccgcgaccagcgccacttcaccagccgcttcgtcagcgaggag
gtcgacctcgccgactacgagaacccgttcggcaccttccccggcggcatggaggacctg
ctctccaccgtccactggctgcagcacacggcccgtgagatgacgcagatgaagtcccgc
tcccagcagatggtcgacgcccggctctacgagttcgaccgggcccgcggcctcgacctg
acccggatgagcaggcgcgaactgcacggcgaactccaccgcgacctcgcctggttccac
gacatgcacatcggctacatgccgtactacatcaacgcgttcgccttctacggcctgctc
accgagctgtgcgcccgctggctcggcagcgacggcgtgggcctgcagaaccgcgtcaag
accgacatgtccagcctgcgcaccgtcgagtcggccaaggaggtctggtcggtcgcccag
gccgccaagaacgacccggccgtcctgcggatcatcaaggacgaaccgctggaggacatc
gcccggctgctgcgcgaggaccccgccggacagcgcttctgggaccggcacatggagccg
ttcctgcgcgccaacggcacccgcggccaccaggagatggagatcacccacccgaggtgg
atcgacgacccctcctacatcttccagatgatccggcgctacgtcgccgacggcttctcc
atcgacgacatcctccgccgcagcagcggctggtccgacgactcccgcgaggtgctgggc
cggctgccgatgcccaagcgccaggtcctggacaccgtcatctccctctacgccctgtgc
agcgagctgcgggagaccacccggatgtccatgatcacgtccatctggctggtgcggaac
gtggtctacgaggtcggccggcgcctggtcgccgacggcgtcctgcactccccggacgag
atcgcccacctggacttcgaggacgtgcgccgctacctcgccggcgacgaggacgccgta
cgcgtcttcgaccgggcccgcatcgacgcggcccgccggctgcacgaacacaacaagcgg
ctcccggaaccgccgttgaccttcgtcggcgtccacgacatcaccgcctcggtccggccc
gccgccgacggcgcccggctcgaaggcctcgccgccagccccggacggatcgtgggccgc
gcccgcatcgtcgaggacctggtgtggcaggccgacgagttcgaggccggggagatcctc
gtgaccgggtacaccgacgcctcctggacgccgctgttcgccatcgcgggcggggtcgtc
accgacatcgggtcgatgctctcgcacagttccatcgtggcccgcgagttccacgtcccg
tcggtggtgaacaccaaggacgccacccagcgcatcaacaccggcgacctgatcgtggtg
gacggcgacgcgggcacggtcgaggtcgtcgagagcgcggacaccgacccgcagggcccg
gccggggccgccgggaccccggccggagccaccaccgactga

DBGET integrated database retrieval system