KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5683
Entry
SCAT_5683         CDS       T01646                                 

Gene name
pcbC
Definition
(GenBank) Isopenicillin N synthetase
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00311  Penicillin and cephalosporin biosynthesis
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
Module
sct_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SCAT_5683 (pcbC)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     SCAT_5683 (pcbC)
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-ProteinID: CCB78370
LinkDB
Position
complement(6109668..6110657)
AA seq 329 aa
MPIPMPSAHVPTIDISPLSGSDADAKSRVAREIHDACRGSGFFYASHHGVDVQLLQDVVN
EFHRTMTDQEKYDLAIHAYNKANPHIRNGYYMAVKGKKAVESFCYLNPAFTDDHPMIKAG
TPLHEVNRWPDEERHPRFRSFCESYYRQMLRLSTVIMRGLALALGKPEHFFDAALAEADT
LSSVSLIRYPYLEDYPPVKTGPDGTKLSFEDHLDVSMITVLFQTEVQNLQVETVDGWRDL
PTSGEDFLVNCGTYLGHVTNDYFPAPNHRVKFVNAERLSLPFFLNAGHHAVIDPFVPEGA
AEPVKNAPLPYGEYLQHGLRALIVKNGQT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcccatcccgatgccctcggcccacgtgccgaccatcgacatctcgccgctgtccggg
tccgacgccgacgccaagtcacgggtcgcgcgggagatccacgacgcgtgccgcggatcc
ggcttcttctacgcctcgcaccacggcgtcgacgtccagctgctccaggacgtggtcaac
gagttccaccggaccatgaccgaccaggagaagtacgacctggcgatccacgcgtacaac
aaggccaacccgcacatccgcaacggctactacatggcggtgaaggggaagaaggccgtc
gagtccttctgctacctcaacccggccttcaccgacgaccacccgatgatcaaggccggt
acgcccctgcacgaggtgaaccggtggccggacgaggaacgccatccgcggttccggtcg
ttctgcgagagctactaccggcagatgctgcggctctccacggtgatcatgcgggggctg
gcgctggcgctggggaagccggagcacttcttcgacgccgcgctcgccgaggccgacacg
ctctcctcggtctccctgatccgctacccgtacctggaggactaccccccggtcaagacc
ggcccggacggcacgaagctgagcttcgaggaccacctggacgtgtcgatgatcaccgtg
ctgttccagacggaggtgcagaacctccaggtggagacggtggacggctggcgtgacctg
ccgacgtccggggaggacttcctggtgaactgcggcacgtacctgggccacgtcaccaac
gactacttcccggcccccaaccaccgggtgaagttcgtcaacgccgaacggctctcgctg
ccgttcttcctcaacgccgggcaccacgccgtcatcgacccgttcgtgccggagggcgcc
gccgagccggtgaagaacgcgccgctgccgtacggcgaatacctccagcacgggctgcgg
gcgctgatcgtcaagaacggccagacctga

DBGET integrated database retrieval system