KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_p0090
Entry
SCAT_p0090        CDS       T01646                                 
Symbol
ptlI
Name
(GenBank) Pentalenene C13 hydroxylase; cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00909  Sesquiterpenoid and triterpenoid biosynthesis
sct00998  Biosynthesis of various antibiotics
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    SCAT_p0090 (ptlI)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SCAT_p0090 (ptlI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sct00199]
    SCAT_p0090 (ptlI)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     SCAT_p0090 (ptlI)
Cytochrome P450 [BR:sct00199]
 Cytochrome P450, bacteria type
  CYP183 family
   SCAT_p0090 (ptlI)
SSDB
Motif
Pfam: p450 SRP72
Other DBs
NCBI-ProteinID: CCB71116
LinkDB
Position
pSCAT:93189..94556
AA seq 455 aa
MASRTCATPVVPGAFPMVGHAWPLMRRPLRFAQSLSGHGDLVEVRLGPVRAQVPCDPELL
WRVLTDDRLFDKGGPFFDRVRATIGNGVGACPYGEHRRQRRLIQPSFQPARLKGYAAVME
EEAAALTERWDDGGVIDAYRSLFGAALRSVLRTLFATRAGDAVVDRFRTSVETVLQQLTA
RMFVPAPLLRLPLPVNRRFDRAVADLRRGIDDLVAERRRDRTDRGDLLSALMTAQDDENG
TGCGTGLTDTEIHDQVLTMLTAGSDSVTAAVSWALYLLDRNPEALDRLEREVDAVLAGRA
ARGDDVPALAHTGRVITEALRLYPPGWLFTRVTTAETELGGHRLPPGTTVAFCAPAVHRG
RQLYDDPEEFDPDRWLPERARTLPRGAFTAFGGGARKCAGEAYALTECTLLLATIVSRWR
LRPAPGCDVRPVALSTALRPRRLLMETSARRGLPK
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcctcgaggacctgcgcgacgccggtggtgcctggggcgttcccgatggtcggccac
gcgtggccgttgatgcgccgtcctctgcggttcgcgcagtcgctgtccggtcacggtgat
ctggtcgaggtacgcctcggcccggtgcgggcccaagtgccgtgcgatcccgagctgttg
tggcgggtgctcaccgacgaccggctcttcgacaagggcggtccgttcttcgaccgggtg
cgcgcgacgatcggcaacggggtcggggcctgcccgtacggcgagcaccgccggcagcgc
cggctcatccagccgtccttccagcccgcgcggttgaagggctatgcggcggtgatggag
gaggaggccgccgcgctgacggagcgctgggacgacggcggggtgatcgacgcctaccgg
tccctgttcggggccgctctgcgctcggtgctgcgcaccctgttcgccacccgggccggc
gatgcggtggtggaccggttccggacctcggtggagacggtgctccagcagctcaccgcc
cggatgttcgtccccgcgccactgctacggctgcccctcccggtcaaccggcggttcgac
cgcgccgtggccgacctgcgacgcggcatcgacgacctggtcgccgagcgccgccgcgac
cgcaccgaccgcggagacctgctctccgccctgatgaccgcccaggacgacgagaacggc
accgggtgcggaaccggcctgacggacaccgagatccacgaccaggtcctcaccatgctg
accgccggctcggacagcgtcaccgccgccgtgtcctgggcgctctacctgctcgaccgg
aaccccgaagcgctcgaccggctggagcgggaggtggacgcggtgctcgccggccgggcc
gcccgtggtgacgacgtccccgctctggcccacaccggccgggtgatcaccgaggcgctg
cgcctgtacccgccaggctggctgttcacgcgggtcaccaccgccgagacggagctgggc
ggccaccgcctgccaccgggaaccaccgtcgccttctgcgcccccgcggtgcaccgcggg
cgccaactgtacgacgatcccgaggagttcgatccggaccggtggctgccggaacgcgcc
cgtaccctgcctcgcggggccttcaccgccttcggcggcggcgcccgcaagtgcgccggc
gaggcctacgccctcaccgaatgcactctgctgctggccacgatcgtcagccgctggcgg
ctgcgccccgcgcccggttgtgacgtccgcccggtggcgctctccaccgcgctgcgcccc
cgacggctgctgatggagacctcggcccgacgcggactcccgaagtga

DBGET integrated database retrieval system