KEGG   Streptomyces cyaneogriseus: TU94_27405
Entry
TU94_27405        CDS       T03687                                 
Name
(GenBank) pentalenene synthase
  KO
K12250  pentalenene synthase [EC:4.2.3.7]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00909  Sesquiterpenoid and triterpenoid biosynthesis
scw00998  Biosynthesis of various antibiotics
scw01100  Metabolic pathways
scw01110  Biosynthesis of secondary metabolites
Module
scw_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    TU94_27405
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    TU94_27405
Enzymes [BR:scw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.7  pentalenene synthase
     TU94_27405
SSDB
Motif
Pfam: Terpene_syn_C_2 Terpene_synth_C
Other DBs
NCBI-ProteinID: AJP04627
UniProt: A0A097ZQB6
LinkDB
Position
6527415..6528428
AA seq 337 aa
MPQDVDFHIPLPARQSPDHARADAEQLAWPRSLGLIKSEAAARRHLRGGYADLASRFYPH
ATGADLDLGVDLMSWFFLFDDLFDGPRGENPEETKRLTDAVAAALDGPLPDTAPPIAHGF
ADIWRRTSEGMTPAWCARSARHWRSYLGGYVDEAESRFRDRPYDSAAQYLAVRRQTIGVQ
PTVDLAERAGRFEVPHRVFDSAVLSAMLQIAVDVNLMLNDIASLEKEEARGEQNNMVMIL
RREHGWSKGRSISHIQQEVHARLEQFLLLESCLPKVADIYRLDEAEREALERYRTDAVRT
VIRGSYDWHRSSGRYDAEFALAAGSQGYLEELGSTAR
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgccccaggatgtcgacttccacatacccctgccggcccggcagagcccggaccacgcg
cgggccgacgccgagcagctcgcctggccgcggtcgctcgggctgatcaagtccgaggcg
gcggcgcggcgtcatctgcgcggcggctacgccgacctggcctcccgcttctacccgcac
gccaccggcgccgacctggacctgggcgtcgacctgatgtcgtggttcttcctcttcgac
gacctcttcgacgggccgcgcggcgagaacccggaggagaccaaacggctcaccgacgcg
gtcgcggcggcgctggacggccccctccccgacaccgcgccccccatcgcccacggcttc
gccgacatctggcggcgcaccagcgagggcatgacacccgcctggtgcgcgcgcagcgcc
cggcactggcgcagctacttgggcggctacgtcgacgaggcggagagccgcttccgggac
aggccgtacgactccgcggcccagtacctggccgtgcgccggcagaccatcggggtgcag
ccgacggtcgacctcgccgaacgcgccggccgcttcgaggtgccgcaccgggtcttcgac
agcgccgtgctctccgcgatgctccagatcgccgtcgacgtcaacctgatgctcaacgac
atcgcctccctggagaaggaagaggcccgcggcgagcagaacaacatggtcatgatcctg
cgccgggagcacggctggtccaagggccgcagcatctcccacatccagcaggaggtgcac
gcccggctcgaacagttcctgctgctggagtcctgcctgccgaaggtcgccgacatctac
cggctcgacgaggccgagcgcgaggcgctggagcggtaccgcacggacgcggtgcgcacg
gtgatccgcgggtcctacgactggcaccgctcctcgggccgctacgacgccgagttcgcg
ctcgcggccggctcccagggctatctggaggagctcggcagcaccgcccgatga

DBGET integrated database retrieval system