KEGG   Streptomyces cyaneogriseus: TU94_27410
Entry
TU94_27410        CDS       T03687                                 
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00909  Sesquiterpenoid and triterpenoid biosynthesis
scw00998  Biosynthesis of various antibiotics
scw01100  Metabolic pathways
scw01110  Biosynthesis of secondary metabolites
Module
scw_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    TU94_27410
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    TU94_27410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:scw00199]
    TU94_27410
Enzymes [BR:scw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     TU94_27410
Cytochrome P450 [BR:scw00199]
 Cytochrome P450, bacteria type
  CYP183 family
   TU94_27410
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AJP04628
UniProt: A0A097ZQC6
LinkDB
Position
6528498..6529892
AA seq 464 aa
MSEQTTFVAGAAPGAVPVVGHALQMMRHPVNFMTSLSAHGDLVQIKIGPTSAYVPTHPDL
LRYVLTNDRIFDKGGVFYDRARDIAGNGLVTCPFADHRRQRRLMQSAFTRTQLKRYATAM
HAEIEATTARWHDGMVVDAFPELYGMALRTVGRTLYSTPVSPELAAGVERAFDVVLNGLF
RQMFLPRFIRRLPLPANRRYESNLRFLHRTTQELIDDYRSDGAAHDDLLAALLASRDDDG
GRLDDKEIHDQVITVMAAGTETVAGTLTWVFYLLSQHPEIEAALYEEIDTVLGGRAPNWD
DVPNLSLADRIISEALRLHPPAWLFTRLTATETELAGRRLPEGTTIVFSPAAVAQYEDAF
GNPTAFDPDRWLPDRVSPAARQAFMPFGTGARKCIGDLYARTEATLGLATILGRWRVTCE
PDMDVRPVPLATVYHPRRLRLRLSARAPRPAATPVPAPTGGEPT
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtccgagcagaccacgttcgtcgcgggcgcggcgcccggggccgtccccgtcgtggga
cacgccctgcagatgatgcgccacccggtgaacttcatgacctcgctgtcggcccacggc
gacctggtgcagatcaagatcggccccacgtcggcctacgtcccgacccaccccgacctg
ctgcggtacgtgctgaccaacgaccgcatcttcgacaagggcggcgtcttctacgaccgg
gcccgcgacatcgccgggaacgggctggtcacctgccccttcgccgaccaccgccggcag
cggcggctgatgcagtcggcgttcacccgcacccagctcaagcggtacgcgacggccatg
cacgccgagatcgaggccacgacggcgcgctggcacgacggcatggtcgtcgacgccttc
cccgagctgtacggcatggccctgcgcacggtcggccgcaccctgtactccaccccggtc
agcccggagctcgcggccggcgtggagcgggccttcgacgtcgtgctcaacgggctgttc
cgccagatgttcctgccccgcttcatccgccgcctgccgctgccggccaaccgccgctac
gagagcaacctgcgcttcctgcaccgcaccacgcaggagctgatcgacgactaccgcagc
gacggcgccgcccacgacgacctgctcgccgcgctgctggcctcccgcgacgacgacggc
ggccggctcgacgacaaggagatccacgaccaggtcatcaccgtgatggccgccggcacc
gagaccgtcgccggcaccctcacctgggtgttctacctgctctcccagcacccggagatc
gaggcggcgctgtacgaggagatcgacaccgtcctcggcggccgcgccccgaactgggac
gacgtgccgaacctctccctggccgaccggatcatctccgaggcgctccggctgcacccg
ccggcctggctgttcacccggctcaccgccaccgagaccgaactggcgggccgcaggctg
cccgagggcaccaccatcgtcttcagcccggccgcggtggcccagtacgaggacgccttc
ggcaaccccacggcgttcgacccggaccgctggctgccggaccgggtctcgcccgcggcc
cgccaggcgttcatgccgttcggcaccggcgcccgcaagtgcatcggcgacctgtacgcg
cgcaccgaggccacgctgggcctggccaccatcctcggccgctggcgggtcacctgcgag
ccggacatggacgtccgtcccgtaccactggccaccgtctaccacccgcgccgcctgcgt
ctgaggctgtccgcgcgcgccccgcgccccgcggccaccccggtgccggcgccgaccggg
ggtgaacccacatga

DBGET integrated database retrieval system