KEGG   Streptomyces cyanogenus: S1361_29875
Entry
S1361_29875       CDS       T07416                                 
Name
(GenBank) Putative polyketide cyclase
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
scyg  Streptomyces cyanogenus
Pathway
scyg01056  Biosynthesis of type II polyketide backbone
scyg01100  Metabolic pathways
scyg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scyg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    S1361_29875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:scyg01004]
    S1361_29875
   01008 Polyketide biosynthesis proteins [BR:scyg01008]
    S1361_29875
Enzymes [BR:scyg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     S1361_29875
Lipid biosynthesis proteins [BR:scyg01004]
 Polyketide synthase
  Component type
   S1361_29875
Polyketide biosynthesis proteins [BR:scyg01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C14 cyclized polyketide type
    Octaketide PKS
     S1361_29875
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc RL10P_insert
Other DBs
NCBI-ProteinID: QTE01575
LinkDB
Position
6649580..6650536
AA seq 318 aa
MTVREVEHAITVQAPAAEVYRLIAEVENWPRVFPPTIYVDQVERGTPGETGVSEERIRIW
ATANGTAKNWTSRRTLDPQALRITFRQEVSAPPVAAMGGTWIIEPLAADESRIRLLHDYR
AIDDDPDSLKWIDEAVDRNSRSELAALKTNVELAHATEEVTFSFEDTVRINGSAKDVYDF
IDEADKWEERLPHVASVRLEELSPGLQILEMDTRTKDGHTHTTKSYRVCFSHQKIAYKQV
TLPALMTLHTGYWTFTENEDGVTASSQHTVVLNTENITRYLGPDAGIAEAREHVQTALSA
NSRATLGLAKDYAEQQQR
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacggtccgtgaggtcgagcacgcgatcaccgtgcaggcccccgccgccgaggtctac
cgcttgatcgccgaggtggagaactggccgcgcgtcttcccgccgaccatctacgtcgac
caggtcgagcggggcactcccggcgagaccggcgtgagcgaggagcgcatccgcatctgg
gccaccgccaacggcacggccaagaactggacctcgcgccgcactctcgacccgcaggcc
ctgcgcatcaccttccgccaggaagtgtccgcgccgccggtcgcggcgatgggcggcacc
tggatcatcgagccgctcgccgcggacgagtccaggatccggctgctccacgactatcgg
gccatcgacgacgatcccgactccctgaagtggatcgacgaggccgtcgaccgcaactcc
cgctcggagctcgccgcactgaagaccaatgtcgaactcgcccacgccaccgaggaggtg
acgttctccttcgaggacaccgtgcggatcaacggctccgcgaaggacgtgtacgacttc
atcgacgaggccgacaagtgggaggagcggttgccgcacgtggcgtccgtgcggcttgag
gagctctccccgggcctgcagatccttgagatggacacccgtaccaaggacgggcacacg
cacaccaccaagtcctaccgcgtgtgcttctcgcaccagaagatcgcgtacaaacaggtc
accctgcccgccctgatgaccctgcacaccggctactggacgttcacggagaacgaggac
ggcgtcaccgcctcctcgcagcacaccgtcgtgctgaacaccgagaacatcaccaggtac
ctcggcccggacgccgggatcgccgaggccagggaacacgtgcagacggccctgagcgcc
aacagccgggccaccctgggtctcgccaaggactacgccgagcagcagcagcgctga

DBGET integrated database retrieval system