KEGG   Streptomyces dangxiongensis: D9753_08680
Entry
D9753_08680       CDS       T08044                                 
Name
(GenBank) cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
sdd  Streptomyces dangxiongensis
Pathway
sdd01056  Biosynthesis of type II polyketide backbone
sdd01100  Metabolic pathways
sdd01110  Biosynthesis of secondary metabolites
Module
sdd_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sdd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    D9753_08680
Enzymes [BR:sdd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     D9753_08680
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc RHH_5
Other DBs
NCBI-ProteinID: AYN38975
UniProt: A0A3G2JC53
LinkDB
Position
1962484..1963473
AA seq 329 aa
MSAERVHHARHEINVAAPASVVYGIVSDAVTWPLYFPPNVHVEQLESDGQRERLRMWATA
NGRTTSWTSRRELDPEARRIEFRQEQSAAPVKSMGGTWIVEPRGAAASRLVLLHDFTVAG
DSADDVAWVERATDTNSRAELGSLKKLAERWTRLGDLALSFEDSVRVDGPAEPVYEFLYR
VRDWPDLVPHVSRLDVVEDESGVQVMSMDTRTADGSTHTTESVRVCFPHAGRIVYKQTVT
PALMSAHIGEWQVVPDVSGVTVTSHHGVVLREENIPRVLGEGAGVAEARSYVREALGRNS
TATLNLAKEYAEKYTEGATRSEISQIKLN
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtctgccgagcgagtgcaccacgccaggcacgagatcaacgtggccgcgccggcgagc
gtggtctacgggatcgtctccgacgcggtcacctggccgctgtacttcccgccgaacgtt
cacgtagagcagctggagtccgacgggcagcgggaacggctgcgcatgtgggccacggcc
aacggccggaccacgtcatggacctcacgccgggagctcgaccccgaggcacggcggatc
gagttccggcaggagcagtcggcggcaccggtgaagtccatgggcgggacctggatcgtc
gagccgcgcggcgccgcggcgtcgcgactggtcctgctgcacgacttcaccgtggcgggc
gattcggcggacgacgtggcgtgggtggagcgtgcgaccgacaccaacagccgtgccgag
ctgggcagtctgaagaagctcgccgagcgctggacgcgtctgggcgacctcgcgctgtcc
ttcgaggactccgtccgggtcgacggaccggccgagccggtctacgagttcctctaccgg
gtgcgcgactggccggacctcgtgccgcacgtgtcccggctggacgtggtggaggacgaa
tccggggtccaggtgatgtcgatggacacccgcaccgcggacggctccacacacaccacc
gaatcggtgcgcgtctgcttcccgcatgcagggcgcatcgtctacaagcagacggtgacg
cccgcgctgatgtcggcccacatcggcgagtggcaggtcgtccccgacgtgtcgggcgtg
acggtcacctcgcatcacggtgtggtcctgcgcgaggagaacatccctcgggtgctcggc
gagggcgccggcgtcgccgaggcgcgctcgtacgtgcgcgaggcgctcggccgcaacagc
accgcgactctcaacctcgcgaaggaatatgccgagaaatacacagagggcgcgaccagg
agtgaaatttcccaaataaagctcaactaa

DBGET integrated database retrieval system