KEGG   Streptomyces dangxiongensis: D9753_34425
Entry
D9753_34425       CDS       T08044                                 
Name
(GenBank) reactive intermediate/imine deaminase
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
sdd  Streptomyces dangxiongensis
Pathway
sdd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:sdd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D9753_34425
Enzymes [BR:sdd01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     D9753_34425
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: AYN44037
UniProt: A0A3G2JS92
LinkDB
Position
7639579..7640514
AA seq 311 aa
MGTVAFGDRFGLAADADGHPELSVPMTSPGFDAFREVWTTTTRPVSGTRDGLHFAHDGEH
LFVSGTITARPVYAPTVRTTYEAAFSLVTELGYPHIFRMWNFVGDILGPNAEGLEIYQDF
VAGRAEAFAAHHGEGTAHMPAATGIGTRGEGIAFVLLAARTSTPRHVENQRQTPAYHYPE
QYGPKPPSFARATLLDPGGTLYVSGTASILGHETVHRGDVAAQTDVVLDNIAELIGGPNL
SAAGLDGGHELKDLRLVKVYVRHERDLPVVRARCREALGPDAEPTFLNVAVCRDDLLVEI
EGLVPGQEWAR
NT seq 936 nt   +upstreamnt  +downstreamnt
ctgggcaccgtcgccttcggtgaccgcttcggcctcgccgccgacgccgacggacacccc
gaactctccgtccccatgacctcgcccggtttcgacgccttccgagaggtgtggaccacc
accacccggcccgtctccggcacccgcgacggactgcacttcgcccacgacggcgaacac
ctcttcgtcagcggcaccatcaccgcgcgccccgtgtacgcgcccaccgtccgcaccacc
tacgaggcggcgttctccctcgtcaccgagctcggttacccccacatcttccggatgtgg
aacttcgtcggagacatcctcggccccaacgccgaaggactggagatataccaggacttc
gtggccggccgcgccgaggcgttcgccgcccaccacggcgaaggcaccgcgcacatgccc
gccgccaccggcatcggcacccgcggcgagggcatcgccttcgtcctgctcgccgcccgc
acctccaccccccggcacgtggagaaccagcgccagacgcccgcctaccactaccccgag
cagtacggcccgaagccgcccagcttcgcccgcgccaccctgctcgaccccggcggcacc
ctctacgtctccggcacggccagcatcctcggccacgagaccgtccaccggggcgacgtc
gccgcccagaccgacgtcgtcctggacaacatcgccgaactcatcggcggccccaacctg
agcgcggcaggactcgacggcggccacgagctcaaggacctgcggctggtcaaggtctac
gtccgccacgaacgcgacctgcccgtcgtccgcgcccgctgccgcgaagccctcggcccc
gacgccgaacccaccttcctcaacgtcgccgtgtgccgtgacgacctcctcgtcgagatc
gaaggactcgtccccggccaggagtgggcccgatga

DBGET integrated database retrieval system