Shewanella denitrificans: Sden_0249 Help Entry Sden_0249         CDS       T00344                                  Name (GenBank) hypothetical protein   KO K01438   acetylornithine deacetylase [EC:3.5.1.16] Organism sdn  Shewanella denitrificans Pathway sdn00220   Arginine biosynthesis sdn01100   Metabolic pathways sdn01110   Biosynthesis of secondary metabolites sdn01210   2-Oxocarboxylic acid metabolism sdn01230   Biosynthesis of amino acids Module sdn_M00028   Ornithine biosynthesis, glutamate => ornithine Brite KEGG Orthology (KO) [BR:sdn00001]  09100 Metabolism   09105 Amino acid metabolism    00220 Arginine biosynthesis     Sden_0249 Enzymes [BR:sdn01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.1  In linear amides     3.5.1.16  acetylornithine deacetylase      Sden_0249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_M20 Motif Other DBs NCBI-ProteinID:  ABE53545 UniProt:  Q12SN1 LinkDB All DBs Position complement(286030..286323) Genome browser AA seq 97 aa AA seqDB search MSNHAVIELLQNWFSEPFAGKADNPWTQLVAELAGSEAEVVKYSTEAPYINKLGCQTLVL GPGSINQAHQPDEFIATEFLTPTVELLKKLVHHACIK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagtaatcatgcagttatcgaattgttgcaaaactggtttagcgagccgtttgctggt aaagccgataacccttggactcaattagttgccgagctcgctggtagtgaggccgaggtc gtcaagtactccaccgaagcgccctatatcaacaagctagggtgccagactttagtcttg ggccctggcagtatcaatcaagctcaccagccggatgagtttattgccactgagtttctc accccaactgtcgaattactcaaaaaactggtgcaccatgcctgtataaaataa

DBGET integrated database retrieval system