KEGG   Streptomyces durmitorensis: M4V62_14525
Entry
M4V62_14525       CDS       T08503                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
sdur  Streptomyces durmitorensis
Pathway
sdur01057  Biosynthesis of type II polyketide products
sdur01100  Metabolic pathways
sdur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdur00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    M4V62_14525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sdur01008]
    M4V62_14525
Polyketide biosynthesis proteins [BR:sdur01008]
 Polyketide tailoring proteins
  Others
   M4V62_14525
SSDB
Other DBs
NCBI-ProteinID: UQT61521
LinkDB
Position
3293033..3294016
AA seq 327 aa
MFLSAVPAAADNEIGGGAQNPGSDSDASGNADGDELSATASGIVYDRSKNGSGPKTGAVT
PATNWTPPPCWYAPTYSPAEFKKYVEPIWQAESTGPQWDLEQKKRYVDGEPYKNFNLDKA
GKGFWWTSFPNKSFPPGWDGCDEPTFWVDKGDPPPADIPEAITPEMLSKLAYAEIRVPGT
EVTLAPEGETKVNLPTWAWLDETEFKPVSVTASVPDIGIEATTTAEPVSLKIDPGTKDAE
TYPASGACPIKNGKIGEPYAKGKSKQDPPCGVRYLRSSGDGSYPLKATVTWKIHWTGTGV
NGEKPLPDGEFGADQDVVVEEVQSINR
NT seq 984 nt   +upstreamnt  +downstreamnt
atgttcctcagcgccgtcccggcggcggctgacaacgagatcggcggcggcgcccagaat
cccggatctgacagcgacgcctcgggcaacgcggacggcgacgaactgtccgccaccgca
tccggcatcgtctacgaccgctccaagaacggctccggccccaagaccggagccgtgacc
cccgccacgaactggaccccgcccccctgctggtacgcacccacgtactcgccggcggag
ttcaagaagtacgtcgagccgatctggcaggccgaatcgaccggcccccagtgggacttg
gagcagaagaagcggtacgtggacggcgagccctacaagaacttcaacctggacaaggcg
ggcaagggcttctggtggacgtccttccccaacaagagcttcccacccggctgggacggc
tgcgacgagcccaccttctgggtggacaagggcgacccgcccccggccgacatccccgaa
gcgataactccggagatgctctccaagctcgcgtacgccgagatccgcgtacccggcacc
gaggtgaccctcgcccctgaaggcgagacgaaggtcaatctgccgacctgggcctggctg
gacgagacggagttcaagccggtgtcggtgacggcgtccgtccccgacatcggcatcgag
gcgacgacaaccgcggagccggtctccctcaagatcgacccgggcacgaaggacgcggag
acctaccccgcctccggtgcctgccccatcaagaacggcaagatcggcgaaccgtacgcc
aagggcaagtccaagcaggacccgccctgcggcgtgaggtacctccgctcctcgggcgac
ggctcgtacccgctcaaggcaacggtcacctggaagatccactggaccggcacaggagtc
aacggcgaaaagccgctacctgacggcgagttcggcgcggatcaggacgtggtggtcgag
gaggtccagtcgatcaaccgatag

DBGET integrated database retrieval system