KEGG   Streptomyces davaonensis: BN159_1442
Entry
BN159_1442        CDS       T02518                                 
Symbol
ptlI
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00909  Sesquiterpenoid and triterpenoid biosynthesis
sdv00998  Biosynthesis of various antibiotics
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    BN159_1442 (ptlI)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    BN159_1442 (ptlI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sdv00199]
    BN159_1442 (ptlI)
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     BN159_1442 (ptlI)
Cytochrome P450 [BR:sdv00199]
 Cytochrome P450, bacteria type
  CYP183 family
   BN159_1442 (ptlI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: CCK25821
UniProt: K4QT57
LinkDB
Position
complement(1563567..1564892)
AA seq 441 aa
MSFTTGTAPGAIPGLGHIWPLMRSPVDFLTSLPDYGDLVEIRLGVTPGYVPCHPELLRQT
LIDDRTFDKGGKYYDRARAMAGNGVATCAHKDHRRQRRMMQPAFHHQQLERYGPVVEEEI
AALTEHWGDEQVIDAYSVLYGLSLRTVTRTLFAAKVDEEVVEGIRHSFDIAFSGFFRQMF
LPRAVLELPLPANRRHRRALGHLRDTVHRVVADSRATEGDEGNVLAALMASEPDDQEIHD
QVVTVLAAGSETVASTLTWALYLLSEHPEAARALQNEIDTVLAGRPARWADIPQLPGLHR
VVNETVRLYPAGWLFTRVTTRDVELAGTLLKEGSTVVITPVPVHRNTELFEDAAAFAPER
WLPERISGLPRGAFAGFGTGPRKCVGDDYGVGECVLALAAILGGWDVQCEPGADTRPVPL
AAFYRPRKLTMRLIRRVGHHG
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtccttcaccacaggcacagcacccggagcgattcccggcctgggacacatctggccc
ctgatgcgaagccccgtcgacttcctgacctccctgccggactacggtgatctcgtcgag
atccggctcggcgtcaccccggggtacgtgccctgccacccggagctgctgcggcagaca
ctgatcgacgaccgcaccttcgacaagggcggcaagtactacgaccgggcccgcgcgatg
gcgggcaacggtgtggcgacctgcgcccacaaggaccaccgccgtcagcggcggatgatg
caacccgccttccatcaccagcagttggagcgctacgggcccgtggtggaggaggagatc
gccgctctcaccgagcactggggcgacgagcaggtgatcgacgcctacagcgtgctgtac
ggcctctcgctgcgcacggtgacccggacgctgttcgcggcgaaggtggacgaggaggtc
gtggagggcatccggcactccttcgacatcgcgttcagcgggttcttccggcagatgttc
ctgccccgcgcggtcctcgaactgccgctgccggccaaccgacggcaccggcgggccctc
gggcatctccgggacaccgtgcaccgggtcgtcgcggactcgcgcgccaccgagggtgac
gaagggaacgtactggcggccctgatggcctccgaacccgacgaccaggagatccacgac
caggtcgtcacggtgctcgccgccggcagcgagaccgtcgcctccaccctgacctgggcc
ctgtatctgctgtccgagcacccggaggcggcgcgggcccttcagaacgagatcgacacc
gtgctggcgggccgcccggcccgctgggcggacatcccacagctgcccggcctccaccgc
gtggtcaacgagaccgtgcggctctatccggccggctggctgttcacccgggtgacgacc
cgcgacgtggaactcgcgggcacgctgctgaaggagggcagcaccgtcgtgatcacgccg
gtgccggtgcaccgcaacacggaactcttcgaggacgccgccgcgttcgcccccgagcgc
tggctcccggaacgcatctccggcctgccccgcggagccttcgcgggcttcggcacggga
ccgcgcaaatgcgtgggcgacgactacggcgtcggcgaatgcgtcctggcgctggcggcg
atcctcggcggctgggacgtacagtgcgagccgggcgcggacacccgaccggtgccgctg
gccgcgttctaccggcctcggaagctcaccatgcgcctgatacgacgggtgggacaccat
ggctga

DBGET integrated database retrieval system