KEGG   Streptomyces davaonensis: BN159_3376
Entry
BN159_3376        CDS       T02518                                 
Name
(GenBank) secreted protein
  KO
K14628  enoyl reductase
Organism
sdv  Streptomyces davaonensis
Pathway
sdv01057  Biosynthesis of type II polyketide products
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    BN159_3376
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sdv01008]
    BN159_3376
Polyketide biosynthesis proteins [BR:sdv01008]
 Polyketide tailoring proteins
  Others
   BN159_3376
SSDB
Other DBs
NCBI-ProteinID: CCK27755
UniProt: K4R3T5
LinkDB
Position
complement(3824493..3825527)
AA seq 344 aa
MPTVRNSARTATALTLVCASLFAAQTAFARGGYDNNGNTEQGADTNGDKVSVTVGGVVFD
RSKNGTGESTGALTSTTSWTPPPCWHAPKYTPEGLQNYLEPIWEAGSTGHTWDAEQREKY
NANDEKKGFNKDKAGKGYWWGAYVNDKDFPAGWDSCYEDEYFWVDTGDAPPADIENAITP
EILAELAYAEIRVPGTEVTLAPENATKVNLPTWAWLDGAEFKPVSVTASVPVLNLEATAT
AVPKSLKIEPGTADAVTYPASGVCELNNANNRIGEPYAKGKADQTPPCGVKYLRSSGDDT
FPLQATVTWEITWTGTGGAGGDMPDGAFGATQDVVVQEIQSINR
NT seq 1035 nt   +upstreamnt  +downstreamnt
gtgccaaccgtaaggaactcagcgaggaccgcaacggccctgacgctcgtatgcgcgtca
ctcttcgctgcccagacagccttcgcccgagggggctacgacaacaacggcaacacggaa
cagggcgccgacaccaacggcgacaaggtttccgtaaccgtcgggggcgtcgtgttcgac
cgctccaagaacggcaccggcgaatcaaccggcgccctgacctcgaccacgtcctggacg
ccgccgccttgttggcacgccccgaagtacacccccgaagggctccagaactacctggag
ccgatctgggaggctggctccacgggtcatacctgggacgccgagcagcgcgagaagtac
aacgccaacgatgagaagaagggcttcaacaaggacaaggccggcaagggctactggtgg
ggcgcgtacgtcaatgacaaggactttcccgcaggttgggactcctgttacgaggacgag
tacttctgggtggacaccggtgatgctcctcccgccgacatcgagaacgcgataaccccc
gagatcctcgccgaactcgcctacgccgagatccgcgtccccggcaccgaggtcaccctc
gcccccgagaacgccacgaaggtcaacctcccgacgtgggcctggctggacggcgcggag
ttcaagccggtgtcagtcaccgcgtccgtaccagtgctgaatctggaggcgaccgcaacc
gcggtgccgaagtccctcaagatcgagccgggtacggcggacgcggtcacctaccccgcg
tccggcgtgtgcgagctcaacaacgccaacaaccgcatcggtgagccgtacgccaagggc
aaggctgaccagactccgccctgcggcgtgaagtacctgcgctcctccggcgacgacacc
ttccccctccaggccaccgtcacgtgggagatcacctggaccggcaccggcggagccggt
ggcgacatgcccgacggtgctttcggcgccacccaggacgtcgtcgtccaggaaatccag
tccatcaaccgctga

DBGET integrated database retrieval system