KEGG   Streptomyces dengpaensis: C4B68_24795
Entry
C4B68_24795       CDS       T06611                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
sdx  Streptomyces dengpaensis
Pathway
sdx01057  Biosynthesis of type II polyketide products
sdx01100  Metabolic pathways
sdx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    C4B68_24795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sdx01008]
    C4B68_24795
Polyketide biosynthesis proteins [BR:sdx01008]
 Polyketide tailoring proteins
  Others
   C4B68_24795
SSDB
Other DBs
NCBI-ProteinID: AVH58457
UniProt: A0A2L2MPD4
LinkDB
Position
5354320..5355378
AA seq 352 aa
MPAVIRLFRLATAAIAAGALCLVSSPSAFADQTPPGGGSIGGGSGSGAGTGATGGTDGDT
INATAGGIVFDRSKNGKGGTVGAVTSTTTWSPPACWYAPKYTPAQLKAYLEPIWEAGSTG
YEWDAQQRDRYVNGDPYKDFNKDKTGKGYWWDSYVDENYPPGWDKCKEPIFWVDEGDDPP
ADIENAVTPEILAELAYAEIRVPSTKVTLAPEGTTKVNLPTWAWLDAAEFKPVSVTASVP
VLGIEATTTAEPVSLKIGPGTEDATTYPASGVCGLNGDRIGEAYAKGKSDETPPCGVRYL
RSSGGGSYQLKATITWKISWTGTGVVGAQRLPDGEFGAEQDVVVQEIQAVNR
NT seq 1059 nt   +upstreamnt  +downstreamnt
gtgccagccgtgatccgactcttccgcttggcaacggctgcgatcgcagcaggagcactc
tgcttggtctcctctccctctgccttcgccgatcaaactcctcccggtggagggtcgatt
ggtggagggtccggctctggggcaggaactggtgccacgggagggactgacggcgacacg
atcaacgcgacggcgggcgggattgtcttcgaccgttcgaagaacggcaagggcggcact
gtgggtgccgtcacgtcgaccacgacctggtccccgccggcctgctggtacgccccgaag
tacacgcctgcgcagctcaaggcgtacttggagccgatctgggaggctggctccacgggt
tacgaatgggatgcgcagcagcgtgaccgttatgtgaacggtgatccctataaggacttc
aacaaggacaagacgggcaagggttactggtgggactcgtacgttgacgagaactaccca
cccggctgggacaagtgtaaggaacctatcttctgggtggacgagggtgatgacccgccc
gctgacatcgagaacgctgtcacgcccgagattcttgccgagctcgcgtacgccgagatc
cgtgtccccagtaccaaggtgactctggcgcccgaaggaacgactaaggtcaacctgccg
acctgggcctggctagacgctgccgagttcaaaccggtttcggtcaccgcgtccgtgccg
gtgctcggcatcgaggcgacaacgacagccgaaccggtgtcgctgaagatcgggccgggc
acggaggacgccacgacatatcccgcttccggtgtctgcgggctcaacggcgatcggatc
ggtgaggcgtacgccaaggggaagtcggacgagaccccaccgtgcggtgtgaggtaccta
cgttcctcgggcgggggctcgtatcagctcaaggccacgatcacctggaagatctcgtgg
acgggcacgggtgtcgtcggtgcgcagcggttgccggacggcgagttcggcgcggagcag
gacgtcgtcgtgcaggagatccaagcggtcaaccgttga

DBGET integrated database retrieval system