Shigella dysenteriae Sd197: SDY_0955 Help Entry SDY_0955          CDS       T00306                                  Symbol yccB Name (GenBank) Uncharacterized protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism sdy  Shigella dysenteriae Sd197 Pathway sdy00190   Oxidative phosphorylation sdy01100   Metabolic pathways sdy02020   Two-component system Module sdy_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sdy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SDY_0955 (yccB)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SDY_0955 (yccB) Enzymes [BR:sdy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      SDY_0955 (yccB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  ABB61127 ShiBASE_China:  SDY0955 UniProt:  Q32HS8 LinkDB All DBs Position 903089..903181 Genome browser AA seq 30 aa AA seqDB search MWYLLWFIGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcatcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgattgaaaagttaa

DBGET integrated database retrieval system