Shigella dysenteriae 1617 (serotype 1): Asd1617_01200 Help Entry Asd1617_01200     CDS       T02933                                  Name (GenBank) Protein ybgT   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism sdz  Shigella dysenteriae 1617 (serotype 1) Pathway sdz00190   Oxidative phosphorylation sdz01100   Metabolic pathways sdz02020   Two-component system Module sdz_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sdz00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Asd1617_01200  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Asd1617_01200 Enzymes [BR:sdz01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Asd1617_01200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  AHA64027 UniProt:  A0A0A6ZPU1 LinkDB All DBs Position 889826..889918 Genome browser AA seq 30 aa AA seqDB search MWYLLWFIGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcatcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgattgaaaagttaa

DBGET integrated database retrieval system