KEGG   Sediminibacillus sp. DP4-553-S: ERJ70_04820
Entry
ERJ70_04820       CDS       T07146                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
sedd  Sediminibacillus sp. DP4-553-S
Brite
KEGG Orthology (KO) [BR:sedd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sedd03000]
    ERJ70_04820
Transcription factors [BR:sedd03000]
 Prokaryotic type
  Other transcription factors
   Others
    ERJ70_04820
SSDB
Motif
Pfam: Bmp Peripla_BP_4 pRN1_helical DHquinase_II Phage_sheath_1N
Other DBs
NCBI-ProteinID: QTN01388
UniProt: A0A8A7TL81
LinkDB
Position
958302..959192
AA seq 296 aa
MGGGEINRVGMLVENSIHDQTWGNKGYQGLLKIKEEYDVDVYFKEGIQTQQDVNRAVEEF
SNQGINLIFGHSSNYGKMLDEINEAYPDIHFVYFNGGYTGDNLTSVNFNSHAMGFFSGMV
AGKMTSTNNVGLIGAFEWQPEIEGFYEGVNYQNPDAYVHMNFVNSWNDSDRALDLLEQMS
AKDVDVFYPTGDQFSVQVINKVKEKGLYAIGYVTDQASLGKNTVLTSTVQHVDDIYLQTA
EAFNEGKLKGDVRTYDFQDGGITMGEFSPEVPESFVEEIQDAIDRYKDTGLLPNEQ
NT seq 891 nt   +upstreamnt  +downstreamnt
atgggtggaggagaaatcaacagggtcggcatgcttgttgaaaattccatccatgatcag
acttggggaaataaaggctatcagggacttttgaaaatcaaagaagaatatgatgtagac
gtatattttaaagaaggtatccaaacacagcaggatgtcaatcgagctgtcgaggaattc
tctaaccaggggattaatttaatctttggtcacagtagtaactacggaaaaatgctcgat
gaaatcaatgaggcgtatccagacattcatttcgtttacttcaatggaggatatacaggt
gataatttgacatccgtcaattttaattctcatgccatgggatttttcagtggaatggtg
gccggaaaaatgacctctaccaacaatgtcggattgatcggtgcttttgaatggcagccg
gaaattgagggcttttatgagggagtcaattaccaaaatcccgacgcatatgtacatatg
aatttcgtgaatagctggaatgacagcgacagggctttggatttgctggaacaaatgagc
gcaaaagacgtcgatgttttctatccgacaggagatcagttcagtgtccaggtgatcaac
aaagtaaaagaaaaaggattatatgcaatcggttatgtcaccgatcaggctagtttgggc
aaaaacacggtattgaccagtaccgttcagcatgtcgatgatatttacttgcaaacagcg
gaagctttcaatgaaggaaaactgaaaggagatgtgaggacatacgactttcaggatgga
ggaatcacaatgggggaattcagtcctgaagtaccggagagctttgttgaagaaatccag
gatgcgattgaccgatataaagacaccggcttgctgccaaatgaacaataa

DBGET integrated database retrieval system