KEGG   Saccharopolyspora erythraea: SACE_1914
Entry
SACE_1914         CDS       T00492                                 

Definition
(GenBank) probable amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00240  Pyrimidine metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SACE_1914
Enzymes [BR:sen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     SACE_1914
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: CAM01225
Kitasato: SACE_1914
Cambridge: SACE_1914
UniProt: A4FB00
LinkDB
Position
complement(2090817..2092292)
AA seq 491 aa
MCADVGIAPGAGLPSSRISDLVLLDAVELSWLIRRREVSCAEVMRTYLDHIDRFNPLVNA
IVSRADDEKLLEQAAKRDEELARGEYKGWMHGFPIAVKDLADAEGFPTSKGSPILAGQTA
DDDEIAVRRMRDAGAIVIGKTNVPEFGLGSHTFNRVFGTTVNPFDPSRSAGGSSGGAAAA
LSLRMLPVADGSDFMGSLRNPAAFCHVLGLRPSFGRVPKPGFLSEPSVAGPMARTVRDLA
MLLSTMAGPDPRAPLGVEQDPAVFAEPLEHRVDGLRIGWLGDFGGYLPTEPGVLAVCASA
LGTFEEIGCVVEPVERELPVEQAWETFLLWRHWMTGQTLHELHADESTRASLKPEAVFEV
EGYLRMGVREIAAALTGRDEWHAHVAALFDDYDFLVAPTAQIFPFDAALRWPSEVGGRTM
DTYHRWMETVAPWTLSGHPVINLPAGFGAADLPMGVQLIGPNHGELDLLRLAHAYERASD
WVHRVLPPPLR
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgtgccgacgtgggcatcgcacccggggcaggcctgccctcctcccgcatctcggac
ctggtgttgctggacgccgtcgagctgtcctggctgatccgccgccgcgaggtctcctgt
gccgaggtgatgcggacctacctggaccacatcgaccgcttcaacccgctggtgaacgcg
atcgtgtcgcgcgccgacgacgagaagctgctcgagcaggccgcgaagcgcgacgaggag
ctggcgcgcggcgagtacaagggctggatgcacggcttcccgatcgcggtgaaggacctc
gccgacgccgagggattccccaccagcaagggttctccgatcctggccgggcagaccgcc
gacgacgacgagatcgccgtgcgccggatgcgcgatgcgggtgccatcgtgatcggcaag
accaacgtgcccgagttcggcctgggttcgcacaccttcaaccgcgtcttcggcaccacg
gtcaacccgttcgacccgtcccggtccgcgggcggcagcagcggcggtgccgcggcggcc
ctgtcgctgcggatgctgccggtcgccgacggcagcgacttcatggggtcgttgcgcaat
cccgccgcgttctgccacgtgctcgggctgcgcccgagcttcggccgcgtcccgaaaccc
ggcttcctcagcgaaccctccgtggccggcccgatggcccgcaccgtgcgcgacctggcg
atgctgctgtccactatggccggacccgatccgcgcgccccgctgggcgtcgagcaggac
cccgcggtgttcgccgaaccgctggagcaccgcgtcgacggcctgcggatcggctggctc
ggcgacttcggcggctacctgccgaccgaacccggcgtgctggcggtgtgcgcctcggcg
ctgggcacattcgaggagatcggctgcgtcgtcgagccggtggagcgcgagctgcccgtc
gagcaggcctgggagacgttcctgctgtggcggcactggatgaccggccagacgctgcac
gagctgcacgccgacgaaagcacccgcgcgtcgctcaaaccggaggcggtcttcgaggtg
gagggctacttgcggatgggggtgcgcgagatcgccgcggcgctcaccggccgcgacgag
tggcacgcgcacgtcgcggcgctcttcgacgactacgacttcctggtcgcgccgaccgcg
cagatcttcccgttcgacgccgcgctgcgctggcccagcgaggtcggcggccggaccatg
gacacctaccaccggtggatggagaccgtggcgccgtggacgttgtccggccacccggtg
atcaacctgcccgccggtttcggcgccgccgacctgccgatgggcgtgcagctgatcggc
ccgaaccacggcgagctggacctgctgcgactcgcccatgcgtatgaacgcgccagcgac
tgggtgcaccgggtgctgccgccaccgctacgttga

DBGET integrated database retrieval system