KEGG   Serratia sp. MYb239: CLM71_22550
Entry
CLM71_22550       CDS       T05477                                 
Name
(GenBank) prodigiosin biosynthesis protein PigM
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
serm  Serratia sp. MYb239
Pathway
serm00333  Prodigiosin biosynthesis
serm01100  Metabolic pathways
serm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CLM71_22550
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase DUF5763
Other DBs
NCBI-ProteinID: AVJ19729
LinkDB
Position
complement(4718270..4719337)
AA seq 355 aa
MMHESFVLALQHALDIARLAPSSHNCQPWSVHYDVVTRCGTLAIDRRRALCGLPSLEREM
LMSCGIFFEYLSALLGYAGRPIEWRWVGDGHGTASDVLIAFSPAAERRADADAHRLLTQA
IAQRHTARSCYQPTRINDEQYIRLKELFAGTAATLSIEQDASLRADIAQLIARHAALDFA
DRRAWQETYQFIRFDERRPADDGFCLHHLFGPVSGSFKYAFRLAFHPRLHRFTTGLRLPE
RMAKGLADLVAQGPQYLAIGLKEECNEALFMTGMRLGRLWLVLQDWGWGLHPLSVLVQHA
APRRELAAALALDEQPVFFARFGHLQQPGSATPRRSWQNILTASRSAPPTGIDTL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgatgcatgaatcgtttgttctggcgctgcagcacgcgctggatattgcgcgcctggcg
ccgtcgtcacataactgccagccctggtcggttcattacgatgttgtaacgcgctgcgga
acgctggcaattgaccggcggcgtgcgttgtgcgggctgccgtcgctggaacgtgaaatg
ctgatgagctgcgggattttctttgaatacctcagtgcgttgctgggctatgccggtcgg
ccgatcgagtggcgctgggtcggggatgggcacggcaccgcctcggacgtgttgatcgct
ttttcccctgcggcggaacggagggcggacgcggatgcgcatcgcctgctgacgcaggcg
atagcgcagcggcatacggcccgttcgtgctatcagccaacgcgcatcaacgatgaacag
tacatacggttgaaggagctatttgccggtacggcggccaccctcagcattgagcaagac
gcgtcgctgcgtgctgatatcgcccagttgatcgcccgtcatgccgctctcgactttgcc
gaccggcgcgcctggcaagaaacttaccagtttattcggtttgatgagcggcgtcctgcc
gacgacggtttctgtctgcatcatctgttcgggccggtgtccggctcgttcaaatacgcc
tttcggctggcgtttcatccgcgcctgcatcgcttcaccaccggtttgcgtctgcccgag
cggatggcgaaggggctggccgatctcgtggcgcagggaccgcaatatctggcgatcggt
ctgaaagaggaatgcaacgaagcgctgtttatgaccgggatgcgcctcggccggctgtgg
ctggtgctgcaagactggggatggggactgcacccgctcagtgtcctggtgcagcatgct
gcaccgcgccgtgagctggccgccgcattggcgcttgacgaacagccggtcttttttgcg
cgtttcggccatctgcagcagccgggcagcgcgacgccaagacgcagttggcaaaacatt
ttaaccgcgtcacgttcggcaccgccgacagggatcgacactttataa

DBGET integrated database retrieval system