KEGG   Serratia sp. MYb239: CLM71_22590
Entry
CLM71_22590       CDS       T05477                                 
Name
(GenBank) aspartate aminotransferase family protein
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
serm  Serratia sp. MYb239
Pathway
serm00333  Prodigiosin biosynthesis
serm01100  Metabolic pathways
serm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CLM71_22590
Enzymes [BR:serm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     CLM71_22590
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5 Shikimate_DH Beta_elim_lyase
Other DBs
NCBI-ProteinID: AVJ19737
LinkDB
Position
complement(4727341..4729899)
AA seq 852 aa
MKFGFIAHPTSVGLKRYVKMLDLLQRNSTELHSGYTRELWQRENLVPFMNFAKITSATGA
TCEGVIKYMPLVADEMLADARTIAGRVLQGIDELVADGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYKAVLQIQSWLDIQADREPVAIVGYPGSICLALSRLLLAQGFS
LHLLHRPGHERDELLSHLPEQYHSQVTLTGDASELYARCKLFIAATSAGGVIDPARLQAG
SIFIDVALPRDIQADTRPERDDILIIDGGCVTASDAVKLGGESLNVTIKQQMNGCMAETI
VLALENRRENFSLGRYLAPEKVLEIGEIAERHGFFAYPLASYGERIDRQSVSHLKRYYHH
EIYAGERGEMSQTSSRLAFVDAIIAQEPAREDTLDRYHQFVNPMMVDFLKLQHCDNVFRH
AAGTQLFTGEGEAFLDMVAGYGCLNLGHNPQPVVDALKNYLDTQGPNFIQYISVPEQTAK
LAEVLCRLAPGKMGRVFFSNSGTEAVEAAMKIAKAATGKPGIVYLQNSYHGKTLGALSIT
GRDKHRRYFKPLLESMVEAPFGDLDALRQALTRDDIGAVMIEPIQGEGGVHIPPEGYLQA
VQQLCRQHDVLLMVDEVQTGLGRTGKLFACEWEGIEPDVLMLSKSLSGGLIPIGATLCRA
DIWQQAYGTADRFLVHSSTYGGGNVASVVALSALREILAQDLAGHAERMGAYFKQALSEI
AARYPFVAEIRGCGLMLGIQFDQTFAGAVSASAREFATRLPGDWHTTWKFLPDPVQAHLR
AAMDRMEQSLGEMFCMKFVTKLCQDHKILTFITANSSTVIRIQPPLIISKAEIDRFVTAF
AAVCDELSTFLK
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgaagttcggattcatcgcacatcccacctcggtagggctgaaacgctacgttaaaatg
ctagacctgctgcagcgcaactcgaccgagctgcacagcggctacacacgcgagctgtgg
cagcgggagaacctggtgccgtttatgaacttcgccaaaattacctcggctaccggcgcc
acctgcgaaggggtgattaaatacatgccgttggtggcggacgaaatgctggccgatgcc
cgcacgatcgccgggcgggtgctgcagggcattgacgaattggtggccgatggcgccgaa
ctggtgggcctgggcggctttacttctatcgtcggccgccgcggcgaagccaccgccgaa
aaatcgccggttcccgtcacctccggtaactcgctgaccacctatgccggctataaagcg
gtgctgcagatccagtcttggctggatattcaggccgatagggagcctgtcgctatcgtc
ggctatccgggctcgatctgcctggcgctcagccgccttctgctggcccaggggttttca
ctccacctgttacaccggcccgggcatgagcgcgacgagctgctcagccatctaccggag
cagtatcactcgcaggtgacgctgaccggcgacgccagcgaactctatgcacgctgcaaa
ctgtttattgccgccacatcggccgggggcgtgatcgaccccgccagactgcaggccggc
tctatttttattgatgtcgcgctgcccagagatattcaggcggatacccgtcccgagcgg
gacgatattctgattatcgatggcggctgcgtcacggcgagcgatgcggtcaaactgggc
ggagagtcgctgaacgtcaccatcaaacagcaaatgaacggctgcatggcggaaaccatc
gtgctggcgttggaaaaccgccgggagaatttctcgctcgggcgctatctggcgccggaa
aaagtgttggaaatcggcgagattgccgagcggcatggcttctttgcctatccgctggcc
tcgtatggcgagcgtatcgaccggcagagcgtcagccaccttaaacgctactatcaccat
gagatttatgccggcgaacgcggcgaaatgtcccagacttcatcccgactggcgtttgtc
gacgccattatcgcccaggagccggcgcgggaagatacgctcgaccgttaccaccagttc
gtcaacccgatgatggtggactttttaaaactgcagcattgcgacaacgtgtttcgtcat
gcggcgggcactcaactattcactggcgaaggggaagccttcctggatatggtggccggc
tacggctgcctcaaccttggccacaatccgcagccggtcgtcgacgcgctgaaaaattac
ctcgatacccagggccccaactttatccaatatatttcggtgcccgaacagaccgctaaa
ctggccgaggtgctctgccgtctggcgcccggcaagatgggcagggtgttcttcagcaac
tcggggactgaagcggtcgaagccgcgatgaagatcgccaaggcggcgactggaaaaccg
ggcatcgtctatctgcaaaacagttaccacggcaaaacgctgggtgcgttgtcgattacc
ggacgcgacaagcaccgccgttatttcaaacccctgttggaatccatggttgaagcgccg
ttcggcgatctggatgcgctgcggcaggcgctgacgcgcgatgatatcggggcggtcatg
atcgaaccgattcaaggggaaggcggggtgcatattcctcctgaaggttatctgcaggcg
gtgcagcaactctgccggcagcatgacgtgctgctgatggttgacgaggtgcagaccggt
ctcggacgtaccggcaaactgttcgcctgcgaatgggaagggatcgagccggatgtactg
atgctgtcgaaatcgctgtccggcggtctgatcccgatcggcgccacgctgtgccgtgcc
gatatctggcagcaggcctacggcaccgcggatcgtttcctggtgcacagctccacctat
ggcggcggcaatgtggcgtcggtcgtggcgctcagcgcgttacgcgagatcctggctcag
gatctcgcggggcacgccgagaggatgggggcctatttcaaacaggcgctgagcgagatc
gccgcccgctatccctttgtggcggagatccgcggttgcggcctgatgctggggatccag
ttcgatcaaacttttgccggcgccgtcagcgcgtccgcccgtgagttcgccacccgtttg
cccggcgactggcacacgacctggaagttcctgcccgatccggtgcaggcccacctgcgc
gccgccatggatcgcatggagcagtcgctcggcgaaatgttctgcatgaaattcgtcacc
aaactgtgccaggaccacaaaatcctgacctttattaccgccaacagctcgacggtaatt
cgtattcagccgccgctcatcatcagcaaagcggagatcgatcgcttcgtcaccgccttc
gccgcggtttgcgatgaattatccacctttttgaaatag

DBGET integrated database retrieval system